Rv0061c Still unknown · low auto-curated

H37Rv Rv0061c · MTBC0 - · 112 aa · 65012–65350 (-) · RefSeq YP_007408697.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 5oun-assembly1_A NMR solution structure of the external DII domain of (prob 0.15, TM 0.64).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6X8E6 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSecreted protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2A57W

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.301 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 25.80% of strains (37464) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 52.4 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5oun-assembly1_A 0.15 0.64 3.7e+00 5oun-assembly1_A NMR solution structure of the external DII domain of Rvb2 from Saccharomyces cerevisiae
5jr8-assembly2_B 0.15 0.66 3.2e+00 5jr8-assembly2_B Disposal of Iron by a Mutant form of Siderocalin NGAL
2fgg-assembly1_A 0.14 0.57 3.2e+00 2fgg-assembly1_A Crystal Structure of Rv2632c
6cib-assembly1_A 0.12 0.69 6.1e+00 6cib-assembly1_A The structure of YcaO from Methanopyrus kandleri bound with AMPPCP and Mg2+
2ys3-assembly1_A 0.09 0.62 5.7e+00 2ys3-assembly1_A Solution structure of the PH domain of Kindlin-3 from human
4qae-assembly6_F 0.09 0.69 8.3e+00 4qae-assembly6_F Crystal structure of an engineered lipocalin (Anticalin) in complex with human hepcidin
4qae-assembly1_A 0.09 0.61 5.7e+00 4qae-assembly1_A Crystal structure of an engineered lipocalin (Anticalin) in complex with human hepcidin
3tdh-assembly1_B 0.08 0.57 5.7e+00 3tdh-assembly1_B Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: celA1 (cellulase CelA), medium confidence from genomic context alone (score 520 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0062 celA1 cellulase CelA 520 520 ctx neighborhood:520
Rv0157A hyp hypothetical protein 870 41 textmining:870
Rv0500A DNA-binding protein 803 41 textmining:803
Rv2310 excisionase 803 41 textmining:803
Rv2660c hyp hypothetical protein 660 41 textmining:660
Rv0842 integral membrane protein 655 41 textmining:655
Rv1584c phage protein 652 41 textmining:652
Rv1954c hyp hypothetical protein 652 41 textmining:652
Rv1374c hyp hypothetical protein 651 41 textmining:651
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 651 41 textmining:651
Rv3750c vapB50 excisionase 516 41 textmining:516
Rv2657c prophage protein 515 41 textmining:515
Rv1734c hyp hypothetical protein 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 5oun-assembly1_A NMR solution structure of the external DII domain of Rvb2 from (prob 0.15, E=4e+00, TM=0.64)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007408697.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A57W
  • Curated reference: UniProt I6X8E6 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 52.4, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor celA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0061c|
MKLKFARLSTAILGCAAALVFPASVASADPPDPHQPDMTKGYCPGGRWGFGDLAVCDGEKYPDGSFWHQWMQTWFTGPQFYFDCVSGGEPLPGPPPPGGCGGAIPSEQPNAP