Rv1948c Family assigned · low

H37Rv Rv1948c · MTBC0 mtbc0_001233 · 33 aa · 1284366–1284467 (+) · RefSeq NP_216464.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Suppressor-of-Fused-like fold (PDB 4KMA); fold characterised, function not established.

Curated reference (UniProt)

UniProt P95266 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B1FN

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.298 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 80.0 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4kma-assembly1_A 1.00 0.60 1.1e-03 sig 4kma-assembly1_A Crystal structure of Drosophila Suppressor of Fused
4bkw-assembly1_A 0.54 0.46 1.3e-01 4bkw-assembly1_A Crystal structure of the C-terminal region of human ZFYVE9
7uzy-assembly1_F 0.04 0.41 4.9e+00 7uzy-assembly1_F Staphylococcus epidermidis RP62A CRISPR effector complex with non-self target RNA 2
8e0b-assembly2_B 0.03 0.53 9.1e+00 8e0b-assembly2_B Crystal structure of human Sar1bT39N
6rwx-assembly1_S 0.03 0.22 3.3e+00 6rwx-assembly1_S Periplasmic inner membrane ring of the Shigella type 3 secretion system
8axn-assembly1_A 0.03 0.21 1.9e+00 8axn-assembly1_A Inner membrane ring and secretin N0 N1 domains of the type 3 secretion system of Shigella flexneri
8sk7-assembly1_X 0.02 0.31 9.7e+00 8sk7-assembly1_X Cryo-EM structure of designed Influenza HA binder, HA_20, bound to Influenza HA (Strain: Iowa43)
3gr1-assembly2_F-5 0.02 0.20 2.6e+00 3gr1-assembly2_F-5 Periplasmic domain of the T3SS inner membrane protein PrgH from S.typhimurium (fragment 170-392)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1949c (Rv1949c, (MTCY09F9.15), len: 319 aa. Conserved hypothetical protein, partial ORF. Rv1949c and Rv1950c|MTCY09F9.14 are similar but frameshift), high confidence from genomic context alone (score 877 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1949c Rv1949c, (MTCY09F9.15), len: 319 aa. Conserved hypothetical protein, partial ORF. Rv1949c and Rv1950c|MTCY09F9.14 are similar but frameshift 877 877 ctx neighborhood:875
Rv1950c hyp hypothetical protein 815 816 ctx neighborhood:814
Rv1951c hyp hypothetical protein 814 815 ctx neighborhood:814
Rv1953 vapC14 ribonuclease VapC14 464 465 ctx neighborhood:463
Rv1952 vapB14 antitoxin VapB14 463 463 ctx neighborhood:463

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 4kma-assembly1_A Crystal structure of Drosophila Suppressor of Fused (prob 1.00, E=1e-03, TM=0.60)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216464.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B1FN
  • Curated reference: UniProt P95266 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 80.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor Rv1949c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001233|Rv1948c|
MSPLIDGEGPGHQYIDDLNSPAPTLMISVDEYA