devR Resolved · high auto-curated

H37Rv Rv3133c · MTBC0 mtbc0_003330 · 217 aa · 3520627–3521280 MTBC0 (-) · RefSeq NP_217649.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component transcriptional regulator DevR
MTBC0 PGAP re-annotationtwo-component system response regulator DevR
Revised (this work)Two-component system response regulator DevR. Pfam: Response_reg (PF00072.31), GerE (PF00196.26).
Functional category (TubercuList)regulatory proteins

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 133 publications

133 TB publications mention this gene. 133 publication(s) discuss this gene (126 in a M. tuberculosis context, 17 in other mycobacteria — M. smegmatis (17)).

Most recent 5 of 133.
PublicationDate
Regulation of Dormancy-Associated Genes dosR by TetR Family Regulator MRA_0776 in Mycobacterium Tuberculosis H37Ra. doi:10.1021/acsomega.5c10658 2026
Granuloma dual RNA-seq reveals composite transcriptional programs driven by neutrophils and necrosis within tuberculous granulomas. doi:10.1126/sciadv.adw4619 2026
Comparison of active and dormant Mycobacterium tuberculosis DosR/DevR regulon polymerase chain reaction-restriction fragment length polymorphism patterns. doi:10.1093/labmed/lmaf046 2025
Granuloma Dual RNA-Seq Reveals Composite Transcriptional Programs Driven by Neutrophils and Necrosis within Tuberculous Granulomas. doi:10.1101/2025.04.26.650783 2025
Expression of Resuscitation-Promoting Factor C Stimulates the Growth of Mycobacterium bovis BCG and Delays DevR Regulon Activation in Hypoxia. doi:10.1155/ijm/2139933 2025

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourdevS (Rv3132c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): DevR-2 (devR).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

Post-translational modifications

3 reported modified residue(s), incl. 2 phosphosite(s): 4-aspartylphosphate @54, Phosphothreonine; by PknH @198, Phosphothreonine; by PknH @205.

Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).

CRISPRi vulnerability

Vulnerability index 1.55 (95% CI -0.95 to 4.90). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionRegulator part of the two component regulatory system DEVR/DEVS/dost. Controls HSPX|Rv2031|ACR expression.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3157c · 100.0% identity
M. marinum MMAR_1516 · 90.1% identity
M. smegmatis MSMEG_5244 · 85.1% identity
M. orygis RJtmp_003227 · 100.0% identity
M. abscessus MAB_3891c · 72.1% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMF9 SwissProt · reviewed · Evidence at protein level
UniProt nameDNA-binding transcriptional activator DevR/DosR
Curated functionMember of the two-component regulatory system DevR/DevS (also called DosR/DosS) involved in onset of the dormancy response. Regulates an approximately 48-member regulon. When phosphorylated binds and activates the promoter of DevR regulon genes in response to hypoxia. The presence of target DNA increases stability of phospho-DevR in vitro. Activates its own transcription under hypoxic but not aerobic conditions, probably binds as a dimer to tandem binding sites within the devR and hspX promoters. Accepts a phosphate group from DevS (DosS) and from DosT. Does not regulate transcription of dosT.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namedevR
eggNOG descriptionRegulator
Orthologous groupCOG2197
KEGG orthology K07695
KEGG pathways map02020
KEGG modules M00482
Gene Ontology (90) GO:0001666, GO:0003674, GO:0003676, GO:0003677, GO:0003700, GO:0005488, GO:0005575, GO:0005576, GO:0005615, GO:0005618, GO:0005622, GO:0005623 +78 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.362 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 84.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 50.9%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 74.0833333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Conditional fitness (RB-TnSeq, 95 conditions) carbon source

ConditionGroupDirectionlog2 fitnesst
Valeric acid carbon source mutant enriched (loss advantageous) 1.207 6.199

Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
altered fitness under 6 weeks hypoxia (stress) -4.960.0 required
altered fitness under 3 weeks hypoxia (stress) -4.780.0 required

Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance1272.0 ppm · rank 172/3519 (95.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length217 aa
Molecular weight23.3 kDa
Theoretical pI5.62
GRAVY-0.017 (hydrophilic)
Aliphatic index106.1
Aromaticity0.028
Instability index32.8 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Response_regPF00072.31 1.9e-234–115 Response regulator receiver domain
GerEPF00196.26 5.8e-18149–204 Bacterial regulatory proteins, luxR family

Experimental structures (Protein Data Bank) 4 solved

PDBMethodResolutionCoverage
3c3w X-ray diffraction 2.2 Å 100%
3c57 X-ray diffraction 1.7 Å 34%
1zlj X-ray diffraction 2.0 Å 34%
1zlk X-ray diffraction 3.1 Å 34%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 84.2

PDB hitprobTM-scoreE-valueDescription
5hev-assembly1_A 1.00 0.62 4.1e-18 sig 5hev-assembly1_A Crystal Structure of the beryllofluoride-activated LiaR from Enterococcus faecium
4gvp-assembly1_A 1.00 0.64 3.3e-17 sig 4gvp-assembly1_A Crystal Structure of the Response Regulator Protein VraR from Staphylococcus aureus
3c3w-assembly1_B 1.00 0.41 3.0e-24 sig 3c3w-assembly1_B Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR
3eul-assembly2_B 1.00 0.96 8.9e-11 sig 3eul-assembly2_B Structure of the signal receiver domain of the putative response regulator NarL from Mycobacterium tuberculosis
7ve6-assembly1_B 1.00 0.91 6.3e-11 sig 7ve6-assembly1_B N-terminal domain of VraR

Foldseek search of the AlphaFold DB model (mean pLDDT 84.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)devS (- strand, -4 bp gap)
Downstream (3' on genome)Rv3134c (- strand, 27 bp gap)
Predicted operon devS · devR · Rv3134c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (3 TF) Rv1353c (activates) · Rv2034 (activates) · devR (activates)
Regulonthis transcription factor regulates 127 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: devS (two component sensor histidine kinase DevS), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3132c devS exp two component sensor histidine kinase DevS 999 1000 ctx neighborhood:882 cooccurence:769 coexpression:895 experimental:544 database:900 textmining:963
Rv3134c universal stress protein 991 954 ctx neighborhood:744 coexpression:805 textmining:818
Rv2027c dosT two component sensor histidine kinase DosT 993 883 ctx cooccurence:767 textmining:946
Rv0845 narS sensor histidine kinase NarS 884 853 ctx cooccurence:726
Rv2005c universal stress protein 866 849 coexpression:848
Rv0569 hyp hypothetical protein 900 832 coexpression:810 textmining:433
Rv1736c narX nitrate reductase-like protein NarX 905 805 coexpression:799 textmining:535
Rv2029c pfkB 6-phosphofructokinase PfkB 901 805 coexpression:734 textmining:515
Rv2623 TB31.7 universal stress protein 932 802 coexpression:772 textmining:671
Rv1997 ctpF cation transporter ATPase F 869 779 coexpression:762 textmining:435
Rv2625c rip3 zinc metalloprotease Rip3 880 765 coexpression:765 textmining:512
Rv2028c universal stress protein 910 752 coexpression:703 textmining:652
Rv2004c hyp hypothetical protein 834 733 coexpression:732 textmining:404
Rv2629 hyp hypothetical protein 794 732 coexpression:732
Rv0195 two component transcriptional regulator 780 704 ctx cooccurence:703

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: two component transcriptional regulator DevR
  • MTBC0 PGAP product: two-component system response regulator DevR
  • Pfam (hmmscan --cut_ga): Response_reg PF00072.31 (E=2e-23), GerE PF00196.26 (E=6e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217649.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Response_reg (PF00072.31), GerE (PF00196.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2197
  • Curated reference: UniProt P9WMF9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 84.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 77 functional partner(s); context anchor devS
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003330|Rv3133c|devR
MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSRPPGDGP