yrbE3A Family assigned · medium auto-curated

H37Rv Rv1964 · MTBC0 mtbc0_002080 · 265 aa · 2226817–2227614 MTBC0 (+) · RefSeq NP_216480.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv1945 (Rv1945) — requalified: HNH endonuclease signature motif containing protein Rv1945 lppG (Rv1946c) — family_assigned: lipoprotein Rv1947 (Rv1947) — family_assigned: hypothetical protein Rv1948c (Rv1948c) — family_assigned: hypothetical protein Rv1950c (Rv1950c) — dark: hypothetical protein Rv1951c (Rv1951c) — dark: hypothetical protein vapB14 (Rv1952) — requalified: antitoxin Rv1954c (Rv1954c) — requalified: hypothetical protein higB (Rv1955) — requalified: type II toxin-antitoxin system toxin HigB higA (Rv1956) — requalified: type II toxin-antitoxin system antitoxin HigA Rv1957 (Rv1957) — requalified: SecB-like chaperone Rv1958c (Rv1958c) — dark: hypothetical protein parE1 (Rv1959c) — family_assigned: type II toxin-antitoxin system RelE/ParE family toxin parD1 (Rv1960c) — family_assigned: type II toxin-antitoxin system ParD family antitoxin Rv1961 (Rv1961) — family_assigned: hypothetical protein vapC35 (Rv1962c) — family_assigned: type II toxin-antitoxin system VapC family toxin mce3R (Rv1963c) — family_assigned: TetR family transcriptional regulator Mce3R mce3R yrbE3A (Rv1964) — family_assigned: ABC transporter permease yrbE3B (Rv1965) — family_assigned: ABC transporter permease mce3B (Rv1967) — family_assigned: virulence factor Mce family protein mce3B mce3C (Rv1968) — family_assigned: virulence factor Mce family protein mce3C mce3D (Rv1969) — family_assigned: virulence factor Mce family protein mce3D lprM (Rv1970) — family_assigned: Mce family lipoprotein LprM lprM mce3F (Rv1971) — family_assigned: MlaD family protein mce3F Rv1972 (Rv1972) — requalified: Mce associated membrane protein Rv1973 (Rv1973) — family_assigned: hypothetical protein Rv1974 (Rv1974) — family_assigned: DUF732 domain-containing protein Rv1975 (Rv1975) — family_assigned: CAP domain-containing protein Rv1976c (Rv1976c) — family_assigned: NYN domain-containing protein 2 216 kb 2 220 kb 2 224 kb 2 228 kb 2 232 kb 2 236 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationABC transporter permease
Revised (this work)ABC transporter permease. Pfam: MlaE (PF02405.22).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 4 publications

4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).

PublicationDate
Mycobacterium tuberculosis Mce3R TetR-like Repressor Forms an Asymmetric Four-Helix Bundle and Binds a Nonpalindrome Sequence†. doi:10.1021/acschembio.4c00687 2024
Mycobacterium tuberculosis YrbE3A Promotes Host Innate Immune Response by Targeting NF-κB/JNK Signaling. doi:10.3390/microorganisms8040584 2020
Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. doi:10.1099/mic.0.027086-0 2009
Negative transcriptional regulation of the mce3 operon in Mycobacterium tuberculosis. doi:10.1099/00221287-148-10-2997 2002

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Mce3R (mce3R).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.13 (95% CI -0.67 to 4.29). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. marinum MMAR_2880 · 88.1% identity
M. smegmatis MSMEG_0344 · 67.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53965 TrEMBL · unreviewed · Predicted
UniProt nameConserved hypothetical integral membrane protein YrbE3A

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred nameyrbE3A
eggNOG descriptionABC-type transport system involved in resistance to organic solvents, permease component
Orthologous groupCOG0767
KEGG orthology K02066
KEGG pathways map02010
KEGG modules M00210, M00669, M00670

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.363 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 1.16% of strains (1678) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 72.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 51.0%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
RD7 62% L6, L9, Microti, Orygis, Bovis, La4, Caprae

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 274.714285714. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) not detected

Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (5 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)5

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length265 aa
Molecular weight27.5 kDa
Theoretical pI6.7
GRAVY1.082 (hydrophobic)
Aliphatic index118.8
Aromaticity0.087
Instability index18.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MlaEPF02405.22 9.9e-5349–257 Permease MlaE

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.8

PDB hitprobTM-scoreE-valueDescription
8fee-assembly1_I 1.00 0.97 6.0e-19 sig 8fee-assembly1_I Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2)
7d06-assembly1_A 1.00 0.92 1.8e-10 sig 7d06-assembly1_A Cryo EM structure of the nucleotide free Acinetobacter MlaFEDB complex
7ch9-assembly1_G 1.00 0.84 9.3e-11 sig 7ch9-assembly1_G Cryo-EM structure of P.aeruginosa MlaFEBD
6z5u-assembly1_A 1.00 0.90 1.0e-09 sig 6z5u-assembly1_A Cryo-EM structure of the A. baumannii MlaBDEF complex bound to APPNHP
8fef-assembly1_J 1.00 0.85 4.5e-10 sig 8fef-assembly1_J Structure of Mce1 transporter from Mycobacterium smegmatis (Map0)

Foldseek search of the AlphaFold DB model (mean pLDDT 85.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 12

Upstream (5' on genome)mce3R (- strand, 897 bp gap)
Downstream (3' on genome)yrbE3B (+ strand, 9 bp gap)
Predicted operon yrbE3A · yrbE3B · mce3A · mce3B · mce3C · mce3D · lprM · mce3F · Rv1972 · Rv1973 · Rv1974 · Rv1975

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (9 TF) Rv0047c (activates) · Rv0081 (activates) · Rv0324 (activates) · mmpR5 (activates) · csoR (represses) · trcR (activates) · Rv1353c (activates) · higA (activates) · Rv1990c (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: mce3F (Mce family protein Mce3F), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1971 mce3F Mce family protein Mce3F 997 996 ctx neighborhood:876 cooccurence:764 coexpression:815 textmining:412
Rv1968 mce3C Mce family protein Mce3C 996 996 ctx neighborhood:876 cooccurence:767 coexpression:831
Rv1967 mce3B Mce family protein Mce3B 995 995 ctx neighborhood:785 cooccurence:767 coexpression:863
Rv1966 mce3A Mce family protein Mce3A 997 994 ctx neighborhood:782 cooccurence:690 coexpression:878 textmining:602
Rv1970 lprM Mce family lipoprotein LprM 993 993 ctx neighborhood:777 cooccurence:752 coexpression:834
Rv1969 mce3D Mce family protein Mce3D 991 991 ctx neighborhood:777 cooccurence:742 coexpression:784
Rv0655 mkl exp ABC transporter ATP-binding protein 991 988 ctx cooccurence:774 coexpression:450 experimental:505 database:800
Rv1965 yrbE3B integral membrane protein 987 985 ctx neighborhood:789 coexpression:860
Rv1972 Mce associated membrane protein 946 946 ctx neighborhood:747 cooccurence:492 coexpression:615
Rv3497c mce4C Mce family protein Mce4C 883 881 ctx cooccurence:768
Rv0590 mce2B Mce-family protein Mce2B; Rv0590, (MTCY19H5.32c), len: 275 aa. Mce2B; belongs to 24-membered Mycobacterium tuberculosis Mce protein family ( 881 879 ctx cooccurence:769
Rv3498c mce4B Mce family protein Mce4B 875 873 ctx cooccurence:769
Rv0170 mce1B Mce family protein Mce1B 874 872 ctx cooccurence:768
Rv3496c mce4D Mce family protein Mce4D 876 871 ctx cooccurence:765
Rv0592 mce2D Mce family protein Mce2D 874 868 ctx cooccurence:757

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: ABC transporter permease
  • Pfam (hmmscan --cut_ga): MlaE PF02405.22 (E=1e-52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216480.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MlaE (PF02405.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0767
  • Curated reference: UniProt O53965 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor mce3F
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002080|Rv1964|yrbE3A
MVIVADKAAGRVADPVLRPVGALGDFFAMTLDTSVCMFKPPFAWREYLLQCWFVARVSTLPGVLMTIPWAVISGFLFNVLLTDIGAADFSGTGCAIFTVNQSAPIVTVLVVAGAGATAMCADLGARTIREELDALRVMGINPIQALAAPRVLAATTVSLALNSVVTATGLIGAFFCSVFLMHVSAGAWVTGLTTLTHTVDVVISMIKATLFGLMAGLIACYKGMSVGGGPAGVGRAVNETVVFAFIVLFVINIVVTAVGIPFMVS