mce3B Family assigned · medium auto-curated

H37Rv Rv1967 · MTBC0 mtbc0_002083 · 342 aa · 2229718–2230746 MTBC0 (+) · RefSeq NP_216483.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv1950c (Rv1950c) — dark: hypothetical protein Rv1951c (Rv1951c) — dark: hypothetical protein vapB14 (Rv1952) — requalified: antitoxin Rv1954c (Rv1954c) — requalified: hypothetical protein higB (Rv1955) — requalified: type II toxin-antitoxin system toxin HigB higA (Rv1956) — requalified: type II toxin-antitoxin system antitoxin HigA Rv1957 (Rv1957) — requalified: SecB-like chaperone Rv1958c (Rv1958c) — dark: hypothetical protein parE1 (Rv1959c) — family_assigned: type II toxin-antitoxin system RelE/ParE family toxin parD1 (Rv1960c) — family_assigned: type II toxin-antitoxin system ParD family antitoxin Rv1961 (Rv1961) — family_assigned: hypothetical protein vapC35 (Rv1962c) — family_assigned: type II toxin-antitoxin system VapC family toxin mce3R (Rv1963c) — family_assigned: TetR family transcriptional regulator Mce3R mce3R yrbE3A (Rv1964) — family_assigned: ABC transporter permease yrbE3B (Rv1965) — family_assigned: ABC transporter permease mce3B (Rv1967) — family_assigned: virulence factor Mce family protein mce3B mce3C (Rv1968) — family_assigned: virulence factor Mce family protein mce3C mce3D (Rv1969) — family_assigned: virulence factor Mce family protein mce3D lprM (Rv1970) — family_assigned: Mce family lipoprotein LprM lprM mce3F (Rv1971) — family_assigned: MlaD family protein mce3F Rv1972 (Rv1972) — requalified: Mce associated membrane protein Rv1973 (Rv1973) — family_assigned: hypothetical protein Rv1974 (Rv1974) — family_assigned: DUF732 domain-containing protein Rv1975 (Rv1975) — family_assigned: CAP domain-containing protein Rv1976c (Rv1976c) — family_assigned: NYN domain-containing protein 2 220 kb 2 224 kb 2 228 kb 2 232 kb 2 236 kb 2 240 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)Mce family protein Mce3B
MTBC0 PGAP re-annotationvirulence factor Mce family protein
Revised (this work)Virulence factor Mce family protein. Pfam: MlaD (PF02470.26), Mce4_CUP1 (PF11887.14).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).

PublicationDate
A Nonsynonymous SNP Catalog of Mycobacterium tuberculosis Virulence Genes and Its Use for Detecting New Potentially Virulent Sublineages. doi:10.1093/gbe/evx053 2017
Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. doi:10.1111/j.0300-9475.2004.01490.x 2004

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

Neighbourmce3A (Rv1966, + strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Mce3R (mce3R).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.40 (95% CI -0.50 to 5.02). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionUnknown, but thought to be involved in host cell invasion.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. marinum MMAR_2883 · 79.8% identity
M. smegmatis MSMEG_0347 · 56.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53968 TrEMBL · unreviewed · Predicted
UniProt nameMce-family protein Mce3B

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namemce3B
eggNOG descriptionVirulence factor Mce family protein
Orthologous groupCOG1463
KEGG orthology K02067
KEGG pathways map02010
KEGG modules M00210, M00669, M00670

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.732 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.183 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 69.9% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 40.1%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
RD7 100% L6, L9, Microti, Orygis, Bovis, La4, Caprae

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 151.923076923. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 1 of 16 independent MS datasets
Integrated abundance0.68 ppm · rank 3327/3519 (5.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (1 TM helix)
DeepTMHMM classTM
TM helices (DeepTMHMM)1

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length342 aa
Molecular weight36.5 kDa
Theoretical pI9.09
GRAVY0.169 (hydrophobic)
Aliphatic index109.3
Aromaticity0.067
Instability index13.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MlaDPF02470.26 1.6e-1938–114 MlaD protein
Mce4_CUP1PF11887.14 9.5e-29120–333 Cholesterol uptake porter CUP1 of Mce4, putative

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.0

PDB hitprobTM-scoreE-valueDescription
8fee-assembly1_B 1.00 0.41 1.1e-29 sig 8fee-assembly1_B Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2)
8fef-assembly1_C 1.00 0.38 1.8e-16 sig 8fef-assembly1_C Structure of Mce1 transporter from Mycobacterium smegmatis (Map0)
8hqa-assembly1_A-3 1.00 0.86 4.5e-10 sig 8hqa-assembly1_A-3 Crystal structure of the ectodomain of the MlaD protein from Escherichia coli in the resting state
6xbd-assembly1_D 1.00 0.75 8.9e-11 sig 6xbd-assembly1_D Cryo-EM structure of MlaFEDB in nanodiscs with phospholipid substrates
8fee-assembly1_C 1.00 0.38 2.0e-14 sig 8fee-assembly1_C Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2)

Foldseek search of the AlphaFold DB model (mean pLDDT 87.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 12

Upstream (5' on genome)mce3A (+ strand, -4 bp gap)
Downstream (3' on genome)mce3C (+ strand, -4 bp gap)
Predicted operon yrbE3A · yrbE3B · mce3A · mce3B · mce3C · mce3D · lprM · mce3F · Rv1972 · Rv1973 · Rv1974 · Rv1975

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (4 TF) Rv0047c (activates) · Rv0081 (activates) · Rv0324 (activates) · Rv1353c (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: yrbE3B (integral membrane protein), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1965 yrbE3B integral membrane protein 996 996 ctx neighborhood:785 cooccurence:773 coexpression:881
Rv1964 yrbE3A integral membrane protein 995 995 ctx neighborhood:785 cooccurence:767 coexpression:863
Rv1971 mce3F Mce family protein Mce3F 996 993 ctx neighborhood:795 cooccurence:774 coexpression:860 textmining:566
Rv1966 mce3A Mce family protein Mce3A 997 992 ctx neighborhood:781 cooccurence:772 coexpression:860 textmining:673
Rv1970 lprM Mce family lipoprotein LprM 995 992 ctx neighborhood:781 cooccurence:774 coexpression:860 textmining:464
Rv1972 Mce associated membrane protein 984 985 ctx neighborhood:729 cooccurence:712 coexpression:822
Rv1968 mce3C Mce family protein Mce3C 986 979 ctx neighborhood:795 coexpression:860
Rv1969 mce3D Mce family protein Mce3D 983 977 ctx neighborhood:781 coexpression:860
Rv1973 Mce associated membrane protein 960 961 ctx neighborhood:714 cooccurence:502 coexpression:746
Rv0655 mkl exp ABC transporter ATP-binding protein 890 885 ctx cooccurence:764 experimental:431
Rv0588 yrbE2B hyp hypothetical protein 881 878 ctx cooccurence:771
Rv0168 yrbE1B membrane protein 910 874 ctx cooccurence:771
Rv0587 yrbE2A hyp hypothetical protein 876 872 ctx cooccurence:766
Rv3500c yrbE4B integral membrane protein 876 872 ctx cooccurence:772
Rv0167 yrbE1A membrane protein 902 870 ctx cooccurence:768

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: Mce family protein Mce3B
  • MTBC0 PGAP product: virulence factor Mce family protein
  • Pfam (hmmscan --cut_ga): MlaD PF02470.26 (E=2e-19), Mce4_CUP1 PF11887.14 (E=1e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216483.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MlaD (PF02470.26), Mce4_CUP1 (PF11887.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1463
  • Curated reference: UniProt O53968 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor yrbE3B
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002083|Rv1967|mce3B
MRENLGGVVVRLGVFLAVCLLTAFLLIAVFGEVRFGDGKTYYAEFANVSNLRTGKLVRIAGVEVGKVTRISINPDATVRVQFTADNSVTLTRGTRAVIRYDNLFGDRYLALEEGAGGLAVLRPGHTIPLARTQPALDLDALIGGFKPLFRALNPEQVNALSEQLLHAFAGQGPTIGSLLAQSAAVTNTLADRDRLIGQVITNLNVVLGSLGAHTDRLDQAVTSLSALIHRLAQRKTDISNAVAYTNAAAGSVADLLSQARAPLAKVVRETDRVAGIAAADHDYLDNLLNTLPDKYQALVRQGMYGDFFAFYLCDVVLKVNGKGGQPVYIKLAGQDSGRCAPK