higA Resolved · high auto-curated

H37Rv Rv1956 · MTBC0 mtbc0_002071 · 149 aa · 2221254–2221703 (+) · RefSeq NP_216472.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin HigA
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin HigA
Revised (this work)Type II toxin-antitoxin system antitoxin HigA. Pfam: HTH_3 (PF01381.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJA7 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin HigA1
Curated functionAntitoxin component of an atypical, type II toxin-antitoxin chaperone (TAC) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin HigB1. Neutralization of HigB1 toxin in E.coli or M.marinum also requires SecB-like chaperone Rv1957, making this the first toxin-antitoxin chaperone (TAC) system. Antitoxin aggregation and degradation are prevented by the chaperone..; FUNCTION: In M.tuberculosis represses expression of the Rv1954A-higB1-higA1-Rv1957 operon promoter but not that of the higB1-higA1-Rv1957 operon.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionHelix-turn-helix
Orthologous groupCOG1396

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.111 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_3PF01381.29 3.6e-1143–92 Helix-turn-helix

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: secBL (SecB-like chaperone), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1957 secBL SecB-like chaperone 999 1000 ctx neighborhood:882 coexpression:716 experimental:999 textmining:870
Rv1955 higB toxin HigB 993 952 ctx neighborhood:682 coexpression:731 experimental:484 textmining:880
Rv3347c PPE55 PPE family protein PPE55 682 683 ctx cooccurence:681
Rv3350c PPE56 PPE family protein PPE56 677 677 ctx cooccurence:676
Rv0355c PPE8 PPE family protein PPE8 675 676 ctx cooccurence:674
Rv0836c hyp hypothetical protein 669 669 ctx cooccurence:667
Rv1004c membrane protein 667 667 ctx cooccurence:665
Rv0304c PPE5 PPE family protein PPE5 666 666 ctx cooccurence:664
Rv1917c PPE34 PPE family protein PPE34 656 656 ctx cooccurence:653
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 643 643 ctx cooccurence:643
Rv3343c PPE54 PPE family protein PPE54 641 642 ctx cooccurence:640
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 638 638 ctx cooccurence:638
Rv0837c hyp hypothetical protein 637 638 ctx cooccurence:633
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 630 630 ctx cooccurence:630
Rv1753c PPE24 PPE family protein PPE24 609 609 ctx cooccurence:609

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin HigA
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin HigA
  • Pfam (hmmscan --cut_ga): HTH_3 PF01381.29 (E=4e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216472.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_3 (PF01381.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1396
  • Curated reference: UniProt P9WJA7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 69 functional partner(s); context anchor secBL
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002071|Rv1956|higA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLSTLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA