cpnT Resolved · high auto-curated

H37Rv Rv3903c · MTBC0 mtbc0_004137 · 846 aa · 4412144–4414684 (-) · RefSeq NP_218420.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationouter membrane channel protein/necrotizing toxin glycohydrolase CpnT
Revised (this work)Outer membrane channel protein/necrotizing toxin glycohydrolase CpnT. Pfam: WXG100_2 (PF25547.2), TNT (PF14021.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05442 SwissProt · reviewed · Evidence at protein level
UniProt nameOuter membrane channel protein CpnT
EC (curated) EC 3.2.2.5
Curated functionHas a dual function in uptake of nutrients and induction of host cell death. The N-terminal domain (NTD) forms an outer membrane channel and is used for uptake of nutrients across the outer membrane. The secreted C-terminal toxic domain (TNT) acts as a glycohydrolase, which hydrolyzes the essential cellular coenzyme NAD(+) in the cytosol of infected macrophages, leading to necrotic host cell death. Both functions are required for survival, replication and cytotoxicity of M.tuberculosis in macrophages.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionBelongs to the bacterial solute-binding protein 9 family
Orthologous groupCOG0803
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.71 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 10 synonymous, 20 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.46% of strains (662) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100_2PF25547.2 5.9e-07132–230 WXG100 like domain
TNTPF14021.13 5.1e-14751–846 Tuberculosis necrotizing toxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxE (ESAT-6 like protein EsxE), high confidence from genomic context alone (score 948 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3902c ift hyp hypothetical protein 996 978 ctx neighborhood:882 experimental:817 textmining:870
Rv3904c esxE ESAT-6 like protein EsxE 985 948 ctx neighborhood:882 coexpression:580 textmining:723
Rv3448 eccD4 ESX-4 secretion system protein EccD4 921 920 ctx cooccurence:595 coexpression:805
Rv3905c esxF ESAT-6 like protein EsxF 981 900 ctx neighborhood:880 textmining:825
Rv3446c hyp hypothetical protein 867 861 coexpression:770
Rv2488c LuxR family transcriptional regulator 820 810 coexpression:804
Rv1359 transcriptional regulator 809 810 coexpression:759
Rv1917c PPE34 PPE family protein PPE34 794 795 ctx cooccurence:757
Rv0339c iniR transcriptional regulator 799 791 ctx cooccurence:562 coexpression:539
Rv3343c PPE54 PPE family protein PPE54 788 788 ctx cooccurence:760
Rv3347c PPE55 PPE family protein PPE55 787 787 ctx cooccurence:760
Rv3350c PPE56 PPE family protein PPE56 786 787 ctx cooccurence:760
Rv0355c PPE8 PPE family protein PPE8 786 787 ctx cooccurence:759
Rv0538 membrane protein 795 782 ctx cooccurence:773
Rv0305c PPE6 PPE family protein PPE6 782 782 ctx cooccurence:755

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: outer membrane channel protein/necrotizing toxin glycohydrolase CpnT
  • Pfam (hmmscan --cut_ga): WXG100_2 PF25547.2 (E=6e-07), TNT PF14021.13 (E=5e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218420.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100_2 (PF25547.2), TNT (PF14021.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0803
  • Curated reference: UniProt O05442 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 184 functional partner(s); context anchor esxE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004137|Rv3903c|cpnT
MAPLAVDPAALDSAGGAVVAAGAGLGAVISSLTAALAGCAGMAGDDPAGAVFGRSYDGSAAALVQAMSVARNGLCNLGDGVRMSAHNYSLAEAMSDVAGRAAPLPAPPPSGCVGVGAPPSAVGGGGGAPKGWGWVAPYIGMIWPNGDSTKLRAAAVAWRSAGTQFALTEIQSTAGPMGVIRAQQLPEAGLIESAFADAYASTTAVVGQCHQLAAQLDAYAARIDAVHAAVLDLLARICDPLTGIKEVWEFLTDQDEDEIQRIAHDIAVVVDQFSGEVDALAAEITAVVSHAEAVITAMADHAGKQWDRFLHSNPVGVVIDGTGQQLKGFGEEAFGMAKDSWDLGPLRASIDPFGWYRSWEEMLTGMAPLAGLGGENAPGVVESWKQFGKSLIHWDEWTTNPNEALGKTVFDAATLALPGGPLSKLGSKGRDILAGVRGLKERLEPTTPHLEPPATPPRPGPQPPRIEPPESGHPAPAPAAKPAPVPANGPLPHSPTESKPPPVDRPAEPVAPSSASAGQPRVSAATTPGTHVPHGLPQPGEHVPAQAPPATTLLGGPPVESAPATAHQPQWATTPAAPAAAPHSTPGGVHSTESGPHGRSLSAHGSEPTHDGASHGSGHGSGSEPPGLHAPHREQQLAMHSNEPAGEGWHRLSDEAVDPQYGEPLSRHWDFTDNPADRSRINPVVAQLMEDPNAPFGRDPQGQPYTQERYQERFNSVGPWGQQYSNFPPNNGAVPGTRIAYTNLEKFLSDYGPQLDRIGGDQGKYLAIMEHGRPASWEQRALHVTSLRDPYHAYTIDWLPEGWFIEVSEVAPGCGQPGGSIQVRIFDHQNEMRKVEELIRRGVLRQ