pks11 Resolved · high auto-curated

H37Rv Rv1665 · MTBC0 mtbc0_001773 · 353 aa · 1903269–1904330 (+) · RefSeq NP_216181.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)chalcone synthase
MTBC0 PGAP re-annotationtype III polyketide synthase
Revised (this work)Type III polyketide synthase. Pfam: Chal_sti_synt_N (PF00195.26), FAE1_CUT1_RppA (PF08392.19), Chal_sti_synt_C (PF02797.22), ACP_syn_III_C (PF08541.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPF3 SwissProt · reviewed · Evidence at protein level
UniProt nameMethyl-branched alkylpyrone synthesis polyketide synthase-like Pks11
EC (curated) EC 2.3.1.-
Curated functionInvolved in the biosynthesis of methyl-branched alkylpyrones. Pks11 catalyzes the extension of medium- and long-chain aliphatic acyl-CoA substrates by using malonyl-CoA and methylmalonyl-CoA as extender molecules to synthesize polyketide products. Palmitoyl-CoA or a similar long chain fatty acid derivative is the likely substrate in vivo.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namepks11
eggNOG descriptionsynthase
Orthologous groupCOG3424
KEGG orthology K16167
Gene Ontology (43) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006629, GO:0006725, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009273, GO:0009698 +31 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.607 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Chal_sti_synt_NPF00195.26 2.2e-219–197 Chalcone and stilbene synthases, N-terminal domain
FAE1_CUT1_RppAPF08392.19 2.4e-1487–199 FAE1/Type III polyketide synthase-like protein
Chal_sti_synt_CPF02797.22 1.9e-16219–351 Chalcone and stilbene synthases, C-terminal domain
ACP_syn_III_CPF08541.17 4.6e-10261–352 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1138c (oxidoreductase), high confidence from genomic context alone (score 786 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1139c hyp hypothetical protein 904 871 ctx cooccurence:774
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 873 855 experimental:470 database:720
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 910 832 database:720 textmining:490
Rv1660 pks10 chalcone synthase 812 810 database:720
Rv1181 pks4 polyketide beta-ketoacyl synthase 829 805 database:720
Rv2931 ppsA phthiocerol synthesis polyketide synthase type I PpsA 816 804 database:720
Rv1138c oxidoreductase 847 786 ctx cooccurence:762
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 801 772 experimental:406 database:628
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 770 771 experimental:406 database:629
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 757 758 database:626
Rv1305 atpE ATP synthase subunit C 764 754 database:610
Rv1180 pks3 polyketide beta-ketoacyl synthase 747 738 database:720
Rv2934 ppsD phthiocerol synthesis polyketide synthase type I PpsD 819 729 database:720
Rv2935 ppsE phthiocerol synthesis polyketide synthase type I PpsE 742 729 database:720
Rv1663 pks17 polyketide synthase 959 685 ctx neighborhood:494 textmining:878

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: chalcone synthase
  • MTBC0 PGAP product: type III polyketide synthase
  • Pfam (hmmscan --cut_ga): Chal_sti_synt_N PF00195.26 (E=2e-21), FAE1_CUT1_RppA PF08392.19 (E=2e-14), Chal_sti_synt_C PF02797.22 (E=2e-16), ACP_syn_III_C PF08541.17 (E=5e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216181.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Chal_sti_synt_N (PF00195.26), FAE1_CUT1_RppA (PF08392.19), Chal_sti_synt_C (PF02797.22), ACP_syn_III_C (PF08541.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3424
  • Curated reference: UniProt P9WPF3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor Rv1138c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001773|Rv1665|pks11
MSVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRHLVLPLQQYPSLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCVAGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGDRRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIERYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALELTWRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLLRWR