tcrA Family assigned · medium auto-curated

H37Rv Rv0602c · MTBC0 - · 253 aa · 699038–699799 (-) · RefSeq NP_215116.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component DNA binding transcriptional regulator TcrA
MTBC0 PGAP re-annotation
Revised (this work)Two component DNA binding transcriptional regulator TcrA. Pfam: Response_reg (PF00072.31), Trans_reg_C (PF00486.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07776 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulatory protein TcrA
Curated functionMember of the three-protein two-component system HK1/HK2/TcrA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred nametcrA
eggNOG descriptionResponse regulator receiver domain
Orthologous groupCOG0745
KEGG orthology K02483
Gene Ontology (35) GO:0000156, GO:0000160, GO:0003674, GO:0005575, GO:0005623, GO:0005886, GO:0007154, GO:0007165, GO:0008150, GO:0009966, GO:0009968, GO:0009987 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.501 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Response_regPF00072.31 5.3e-3125–134 Response regulator receiver domain
Trans_reg_CPF00486.35 6.2e-23168–242 Transcriptional regulatory protein, C terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0601c (two component sensor kinase HK2), high confidence from genomic context alone (score 967 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0601c two component sensor kinase HK2 987 967 ctx neighborhood:700 cooccurence:616 coexpression:606 textmining:644
Rv0600c two component sensor kinase HK1 970 938 ctx neighborhood:441 cooccurence:762 textmining:541
Rv0603 hyp hypothetical protein 935 936 ctx neighborhood:559 coexpression:860
Rv1032c trcS two component sensor histidine kinase TrcS 899 872 ctx cooccurence:706
Rv0902c prrB two component sensor histidine kinase PrrB 944 870 ctx cooccurence:700 textmining:594
Rv1675c cmr HTH-type transcriptional regulator Cmr 877 870 coexpression:854
Rv0982 mprB two component histidine-protein kinase/phosphatase MprB 872 867 ctx cooccurence:696
Rv3840 transcriptional regulator 865 860 coexpression:860
Rv3167c TetR family transcriptional regulator 859 859 coexpression:859
Rv3764c tcrY two component sensor kinase TcrY 888 858 ctx cooccurence:672
Rv1359 transcriptional regulator 858 858 coexpression:839
Rv0758 phoR two component system response sensor kinase PhoR 877 852 ctx cooccurence:742
Rv0490 senX3 two component sensor histidine kinase SenX3 889 850 ctx cooccurence:737
Rv1776c transcriptional regulator 848 848 coexpression:848
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 848 848 coexpression:848

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): two component DNA binding transcriptional regulator TcrA
  • Pfam (hmmscan --cut_ga): Response_reg PF00072.31 (E=5e-31), Trans_reg_C PF00486.35 (E=6e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215116.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Response_reg (PF00072.31), Trans_reg_C (PF00486.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0745
  • Curated reference: UniProt O07776 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 102 functional partner(s); context anchor Rv0601c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0602c|tcrA
MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEEGHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARGAVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRVWRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDKIDRPFGVTSLETIRGAGYRLRKDGGRHALPR