Rv2282c Family assigned · medium auto-curated

H37Rv Rv2282c · MTBC0 mtbc0_002423 · 312 aa · 2579685–2580623 MTBC0 (-) · RefSeq NP_216798.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)LysR family HTH-type transcriptional regulator
MTBC0 PGAP re-annotationLysR family transcriptional regulator
Revised (this work)LysR family transcriptional regulator. Pfam: HTH_1 (PF00126.34), LysR_substrate (PF03466.26).
Functional category (TubercuList)regulatory proteins

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.48 (95% CI -2.13 to 3.85). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2303c · 100.0% identity
M. marinum MMAR_3419 · 81.2% identity
M. smegmatis MSMEG_2797 · 66.3% identity
M. orygis RJtmp_002356 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMF3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized HTH-type transcriptional regulator Rv2282c

UniProt still lists this protein as Uncharacterized HTH-type transcriptional regulator Rv2282c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionBacterial regulatory helix-turn-helix protein, lysR family
Orthologous groupCOG0583
Gene Ontology (8) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (222) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) inf (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 38/53 (72%) · mean identity 74.3% · 2/4 closest MTBAP relatives
conserved across the genus (present in 38/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 41.4%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 0.929, mean read count 37.6923076923. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
altered fitness under acid stress in phosphate-citrate buffer (stress) +2.750.0 disruption advantageous

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance15.6 ppm · rank 2473/3519 (29.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length312 aa
Molecular weight33.0 kDa
Theoretical pI10.2
GRAVY0.159 (hydrophobic)
Aliphatic index107.4
Aromaticity0.026
Instability index47.0 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_1PF00126.34 1.0e-1913–68 Bacterial regulatory helix-turn-helix protein, lysR family
LysR_substratePF03466.26 4.1e-3695–306 LysR substrate binding domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.0

PDB hitprobTM-scoreE-valueDescription
8sbf-assembly1_D 1.00 0.63 5.7e-25 sig 8sbf-assembly1_D Full-length structure of the LysR-type transcriptional regulator, ACIAD0746, from Acinetobacter baylyi
8sbh-assembly1_B 1.00 0.85 4.5e-19 sig 8sbh-assembly1_B YeiE effector binding domain from E. coli
7erq-assembly1_B 1.00 0.80 5.8e-18 sig 7erq-assembly1_B The regulatory domain of YeiE, a sulfite sensing LysR-type transcriptional regulator from Cronobacter sakazakii (ligand-free form)
5y2v-assembly1_C 1.00 0.54 1.7e-21 sig 5y2v-assembly1_C Strcutrue of the full-length CcmR complexed with 2-OG from Synechocystis PCC6803
1ixc-assembly1_B-2 1.00 0.55 1.3e-20 sig 1ixc-assembly1_B-2 Crystal structure of CbnR, a LysR family transcriptional regulator

Foldseek search of the AlphaFold DB model (mean pLDDT 91.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)pitB (+ strand, 106 bp gap)
Downstream (3' on genome)Rv2283 (+ strand, 64 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (1 TF) Rv2282c (activates)
Regulonthis transcription factor regulates 1 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1675c cmr HTH-type transcriptional regulator Cmr 869 862 coexpression:862
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 853 851 coexpression:833
Rv3840 transcriptional regulator 854 848 coexpression:848
Rv0117 oxyS oxidative stress response regulatory protein OxyS 846 847 coexpression:803
Rv1674c transcriptional regulator 848 839 coexpression:812
Rv3736 AraC/XylS family transcriptional regulator 845 837 coexpression:837
Rv3830c TetR family transcriptional regulator 836 834 coexpression:813
Rv3167c TetR family transcriptional regulator 836 831 coexpression:810
Rv1267c embR transcriptional regulator EmbR 833 827 coexpression:827
Rv2488c LuxR family transcriptional regulator 835 826 coexpression:826
Rv1556 HTH-type transcriptional regulator 830 825 coexpression:803
Rv1151c cobB NAD-dependent protein deacylase 823 824 coexpression:823
Rv1189 sigI ECF RNA polymerase sigma factor SigI 820 813 coexpression:813
Rv1776c transcriptional regulator 864 811 coexpression:788
Rv1027c kdpE transcriptional regulator KdpE 820 810 coexpression:810

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: LysR family HTH-type transcriptional regulator
  • MTBC0 PGAP product: LysR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): HTH_1 PF00126.34 (E=1e-19), LysR_substrate PF03466.26 (E=4e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216798.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_1 (PF00126.34), LysR_substrate (PF03466.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0583
  • Curated reference: UniProt P9WMF3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 70 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002423|Rv2282c|
MPLSSRMPGLTCFEIFLAIAEAGSLGGAARELGLTQQAVSRRLASMEAQIGVRLAIRTTRGSQLTPAGIVVAEWAARLLEVADEIDAGLGSLRTEGRQRIRVVASQTIAEQLMPHWMLSLRAADMRRGGTVPEVILTATNSEHAIAAVRDGIADLGFIENPCPPTGLGSVVVARDELVVVVPPGHKWARRSRVVSARELAQTPLVTREPNSGIRDSLTAALRDTLGEDMQQAPPVLELSSAAAVRAAVLAGAGPAAMSRLAIADDLAFGRLLAVDIPALNLRRQLRAIWVGGRTPPAGAIRDLLSHITSRST