embR Resolved · high auto-curated

H37Rv Rv1267c · MTBC0 mtbc0_001357 · 388 aa · 1425164–1426330 (-) · RefSeq NP_215783.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator EmbR
MTBC0 PGAP re-annotationresponse regulator transcription factor EmbR
Revised (this work)Response regulator transcription factor EmbR. Pfam: Trans_reg_C (PF00486.35), BTAD (PF03704.24), Yop-YscD_cpl (PF16697.11), FHA (PF00498.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGJ9 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulatory protein EmbR
Curated functionPositively regulates the transcription of the embCAB operon. Exhibits ATPase and GTPase activities.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameembR
eggNOG descriptioninvolved in transcriptional mechanism. thought to regulate the biosynthesis of the mycobacterial cell wall arabinan and resistance to ethambutol (Emb
Orthologous groupCOG1716
Gene Ontology (41) GO:0003674, GO:0003676, GO:0003677, GO:0003824, GO:0003924, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006355, GO:0008150 +29 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.582 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Trans_reg_CPF00486.35 1.8e-1031–103 Transcriptional regulatory protein, C terminal
BTADPF03704.24 2.2e-49110–255 Bacterial transcriptional activator domain
Yop-YscD_cplPF16697.11 1.4e-10297–378 Inner membrane component of T3SS, cytoplasmic domain
FHAPF00498.32 1.0e-17308–371 FHA domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0894 (transcriptional regulator), high confidence from genomic context alone (score 967 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0894 transcriptional regulator 968 967 ctx fusion:774 coexpression:800
Rv2488c LuxR family transcriptional regulator 935 931 ctx fusion:454 coexpression:859
Rv0339c iniR transcriptional regulator 899 897 ctx cooccurence:506 coexpression:800
Rv3263 DNA methylase 875 876 coexpression:850
Rv1963c mce3R transcriptional repressor Mce3R 870 868 coexpression:815
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 863 860 coexpression:860
Rv3167c TetR family transcriptional regulator 863 860 coexpression:860
Rv1931c transcriptional regulator 862 860 coexpression:860
Rv1151c cobB NAD-dependent protein deacylase 860 860 coexpression:860
Rv0212c nadR transcriptional regulator NadR 860 860 coexpression:860
Rv1674c transcriptional regulator 860 860 coexpression:860
Rv1675c cmr HTH-type transcriptional regulator Cmr 860 860 coexpression:860
Rv1027c kdpE transcriptional regulator KdpE 864 859 coexpression:859
Rv3736 AraC/XylS family transcriptional regulator 859 859 coexpression:859
Rv3055 TetR family transcriptional regulator 860 857 coexpression:804

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator EmbR
  • MTBC0 PGAP product: response regulator transcription factor EmbR
  • Pfam (hmmscan --cut_ga): Trans_reg_C PF00486.35 (E=2e-10), BTAD PF03704.24 (E=2e-49), Yop-YscD_cpl PF16697.11 (E=1e-10), FHA PF00498.32 (E=1e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215783.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Trans_reg_C (PF00486.35), BTAD (PF03704.24), Yop-YscD_cpl (PF16697.11), FHA (PF00498.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1716
  • Curated reference: UniProt P9WGJ9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 122 functional partner(s); context anchor Rv0894
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001357|Rv1267c|embR
MAGSATVEKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHGGT