bcpB Resolved · high auto-curated
H37Rv Rv1608c · MTBC0 mtbc0_001714 ·
154 aa · 1819262–1819726 (-) ·
RefSeq NP_216124.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | peroxiredoxin |
|---|---|
| MTBC0 PGAP re-annotation | peroxiredoxin BcpB |
| Revised (this work) | Peroxiredoxin BcpB. Pfam: Redoxin (PF08534.17), AhpC-TSA (PF00578.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WID9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative peroxiredoxin Rv1608c |
| EC (curated) |
EC 1.11.1.24
|
| Curated function | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. |
UniProt still lists this protein as Putative peroxiredoxin Rv1608c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | bcpB |
| eggNOG description | Peroxiredoxin |
| Orthologous group | COG1225 |
| EC number |
EC 1.11.1.15
|
| KEGG orthology |
K03564
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Redoxin | PF08534.17 | 5.1e-20 | 2–143 | Redoxin |
AhpC-TSA | PF00578.28 | 9.8e-33 | 4–127 | AhpC/TSA family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1610 (membrane protein), high confidence from genomic context alone (score 773 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1610 |
membrane protein | 773 | 773 ctx | neighborhood:773 |
Rv1609 trpE |
anthranilate synthase component I | 773 | 773 ctx | neighborhood:773 |
Rv1611 trpC |
indole-3-glycerol phosphate synthase | 708 | 709 ctx | neighborhood:707 |
Rv1612 trpB |
tryptophan synthase subunit beta | 671 | 672 ctx | neighborhood:670 |
Rv1613 trpA |
tryptophan synthase subunit alpha | 671 | 672 ctx | neighborhood:670 |
Rv1614 lgt |
prolipoprotein diacylglyceryl transferase | 659 | 645 ctx | neighborhood:640 |
Rv2428 ahpC |
alkyl hydroperoxide reductase subunit AhpC | 458 | 414 | |
Rv1229c mrp |
multiple resistance/pH adaptation protein | 432 | 396 | |
Rv2238c ahpE |
peroxiredoxin | 566 | 283 | textmining:420 |
Rv3250c rubB |
rubredoxin RubB | 504 | 115 | textmining:464 |
Rv3110 moaB1 |
pterin-4-alpha-carbinolamine dehydratase | 631 | 93 | textmining:611 |
Rv0865 mog |
molybdopterin biosynthesis protein | 720 | 90 | textmining:705 |
Rv0984 moaB2 |
pterin-4-alpha-carbinolamine dehydratase | 494 | 90 | textmining:467 |
Rv2131c cysQ |
3'(2'),5'-bisphosphate nucleotidase CysQ | 679 | 80 | textmining:666 |
Rv2763c dfrA |
dihydrofolate reductase | 406 | 72 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: peroxiredoxin
- MTBC0 PGAP product: peroxiredoxin BcpB
- Pfam (hmmscan --cut_ga): Redoxin PF08534.17 (E=5e-20), AhpC-TSA PF00578.28 (E=1e-32)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216124.1)
- Domains: Pfam-A via hmmscan --cut_ga — Redoxin (PF08534.17), AhpC-TSA (PF00578.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1225 - Curated reference: UniProt P9WID9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
Rv1610 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001714|Rv1608c|bcpB MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVRKQAKFAEVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRSG