bcpB Resolved · high auto-curated

H37Rv Rv1608c · MTBC0 mtbc0_001714 · 154 aa · 1819262–1819726 (-) · RefSeq NP_216124.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peroxiredoxin
MTBC0 PGAP re-annotationperoxiredoxin BcpB
Revised (this work)Peroxiredoxin BcpB. Pfam: Redoxin (PF08534.17), AhpC-TSA (PF00578.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WID9 SwissProt · reviewed · Evidence at protein level
UniProt namePutative peroxiredoxin Rv1608c
EC (curated) EC 1.11.1.24
Curated functionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events.

UniProt still lists this protein as Putative peroxiredoxin Rv1608c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namebcpB
eggNOG descriptionPeroxiredoxin
Orthologous groupCOG1225
EC number EC 1.11.1.15
KEGG orthology K03564

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RedoxinPF08534.17 5.1e-202–143 Redoxin
AhpC-TSAPF00578.28 9.8e-334–127 AhpC/TSA family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1610 (membrane protein), high confidence from genomic context alone (score 773 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1610 membrane protein 773 773 ctx neighborhood:773
Rv1609 trpE anthranilate synthase component I 773 773 ctx neighborhood:773
Rv1611 trpC indole-3-glycerol phosphate synthase 708 709 ctx neighborhood:707
Rv1612 trpB tryptophan synthase subunit beta 671 672 ctx neighborhood:670
Rv1613 trpA tryptophan synthase subunit alpha 671 672 ctx neighborhood:670
Rv1614 lgt prolipoprotein diacylglyceryl transferase 659 645 ctx neighborhood:640
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 458 414
Rv1229c mrp multiple resistance/pH adaptation protein 432 396
Rv2238c ahpE peroxiredoxin 566 283 textmining:420
Rv3250c rubB rubredoxin RubB 504 115 textmining:464
Rv3110 moaB1 pterin-4-alpha-carbinolamine dehydratase 631 93 textmining:611
Rv0865 mog molybdopterin biosynthesis protein 720 90 textmining:705
Rv0984 moaB2 pterin-4-alpha-carbinolamine dehydratase 494 90 textmining:467
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 679 80 textmining:666
Rv2763c dfrA dihydrofolate reductase 406 72

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peroxiredoxin
  • MTBC0 PGAP product: peroxiredoxin BcpB
  • Pfam (hmmscan --cut_ga): Redoxin PF08534.17 (E=5e-20), AhpC-TSA PF00578.28 (E=1e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216124.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Redoxin (PF08534.17), AhpC-TSA (PF00578.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1225
  • Curated reference: UniProt P9WID9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv1610
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001714|Rv1608c|bcpB
MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVRKQAKFAEVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRSG