trpA Family assigned · medium auto-curated
H37Rv Rv1613 · MTBC0 mtbc0_001719 ·
270 aa ·
1824323–1825135 MTBC0
(+) ·
RefSeq NP_216129.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | tryptophan synthase subunit alpha |
|---|---|
| MTBC0 PGAP re-annotation | tryptophan synthase subunit alpha |
| Revised (this work) | Tryptophan synthase subunit alpha. Pfam: Trp_syntA (PF00290.27). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Infectious diseases detected by screening after arrival to Denmark in internationally adopted children. doi:10.1111/apa.15045 | 2020 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | trpB (Rv1612, + strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -7.19 (95% CI -7.75 to -6.61). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Tryptophan biosynthesis pathway (fifth - last step). The alpha subunit is responsible for the ALDOL cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3- phosphate. [catalytic activity: L-serine + 1-(indol-3-YL)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H(2)O.] |
|---|---|
| Mycobrowser EC |
4.2.1.20
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1639
· 100.0% identity |
|---|---|
| M. leprae |
ML1273
· 86.0% identity |
| M. marinum |
MMAR_2415
· 87.1% identity |
| M. smegmatis |
MSMEG_3221
· 79.3% identity |
| M. orygis |
RJtmp_001685
· 100.0% identity |
| M. abscessus |
MAB_2643c
· 72.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFY1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Tryptophan synthase alpha chain |
| EC (curated) |
EC 4.2.1.20
|
| Curated function | The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | trpA |
| eggNOG description | The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3- phosphate |
| Orthologous group | COG0159 |
| EC number |
EC 4.2.1.20
|
| KEGG orthology |
K01695
|
| KEGG pathways |
map00260, map00400, map01100, map01110, map01130, map01230
|
| KEGG modules |
M00023
|
| Gene Ontology (8) |
GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.228 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 19 in the ORF — 17 in the essential state, 2 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.105, mean read count 4. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | trpA-TetOn 6.1 (TetON promoter 6) |
|---|---|
| Baseline knockdown fitness | 1.392 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - slow growth (less than 1 doubling in a screening wave)) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 382.0 ppm · rank 523/3519 (85.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 270 aa |
|---|---|
| Molecular weight | 27.7 kDa |
| Theoretical pI | 4.94 |
| GRAVY | 0.3 (hydrophobic) |
| Aliphatic index | 102.0 |
| Aromaticity | 0.048 |
| Instability index | 34.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Trp_syntA | PF00290.27 | 7.6e-68 | 16–249 | Tryptophan synthase alpha chain |
Experimental structures (Protein Data Bank) 12 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5tch |
X-ray diffraction | 2.35 Å | 100% |
5tcg |
X-ray diffraction | 2.4 Å | 100% |
5tcj |
X-ray diffraction | 2.4 Å | 100% |
6u6c |
X-ray diffraction | 2.402 Å | 100% |
6usa |
X-ray diffraction | 2.406 Å | 100% |
5tci |
X-ray diffraction | 2.45 Å | 100% |
5tcf |
X-ray diffraction | 2.46 Å | 100% |
6e9p |
X-ray diffraction | 2.569 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (12 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5ey5-assembly1_A |
1.00 | 0.92 | 8.4e-26 sig | 5ey5-assembly1_A LBCATS |
7lvx-assembly1_A |
1.00 | 0.90 | 1.5e-22 sig | 7lvx-assembly1_A The internal aldimine form of the wild-type Salmonella Typhimurium Tryptophan Synthase in complex with N-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (F9F) at the enzyme alpha-site and cesium ion at the metal coordination site at 1.55 Angstrom resolution |
7ki7-assembly1_A-2 |
1.00 | 0.90 | 3.1e-22 sig | 7ki7-assembly1_A-2 The external aldimine crystal structure of the beta-K167T mutant Tryptophan Synthase at 1.75 Angstrom resolution in complex with N-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (F9F) at the enzyme alpha-site and cesium ion at the metal coordination site |
7mt4-assembly1_A |
1.00 | 0.90 | 3.5e-22 sig | 7mt4-assembly1_A Crystal structure of tryptophan Synthase in complex with F9, NH4+, pH7.8 - alpha aminoacrylate form - E(A-A) |
6duc-assembly1_A-2 |
1.00 | 0.89 | 3.5e-22 sig | 6duc-assembly1_A-2 Crystal structure of mutant beta-K167T tryptophan synthase in complex with inhibitor N-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (F9F) at the alpha-site, cesium ion at the metal coordination site, and 2-aminophenol quinonoid (1D0) at the beta-site |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | trpB (+ strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | lgt (+ strand, -1 bp gap) |
| Predicted operon |
trpB · trpA · lgt
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: trpC (indole-3-glycerol phosphate synthase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1611 trpC exp |
indole-3-glycerol phosphate synthase | 999 | 1000 ctx | neighborhood:793 cooccurence:774 coexpression:925 database:900 textmining:754 |
Rv1612 trpB exp |
tryptophan synthase subunit beta | 999 | 1000 ctx | neighborhood:882 fusion:900 cooccurence:774 coexpression:979 experimental:999 database:900 textmining:843 |
Rv1614 lgt |
prolipoprotein diacylglyceryl transferase | 995 | 996 ctx | neighborhood:882 coexpression:964 |
Rv1609 trpE |
anthranilate synthase component I | 995 | 975 ctx | neighborhood:721 cooccurence:767 coexpression:651 textmining:818 |
Rv2192c trpD |
anthranilate phosphoribosyltransferase | 994 | 973 ctx | cooccurence:774 coexpression:857 textmining:790 |
Rv0013 trpG |
anthranilate synthase component II | 974 | 964 ctx | cooccurence:760 coexpression:819 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 941 | 941 | coexpression:941 |
Rv1559 ilvA exp |
threonine dehydratase IlvA | 934 | 924 | database:900 |
Rv2386c mbtI |
salicylate synthase | 958 | 922 ctx | cooccurence:761 coexpression:648 textmining:487 |
Rv1093 glyA1 exp |
serine hydroxymethyltransferase | 922 | 912 | database:900 |
Rv0070c glyA2 exp |
serine hydroxymethyltransferase | 921 | 911 | database:900 |
Rv3042c serB2 exp |
phosphoserine phosphatase SerB | 910 | 908 | database:900 |
Rv1077 cbs exp |
cystathionine beta-synthase | 915 | 906 | database:900 |
Rv0069c sdaA exp |
L-serine dehydratase | 908 | 905 | database:900 |
Rv0436c pssA exp |
CDP-diacylglycerol--serine O-phosphatidyltransferase | 900 | 901 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: tryptophan synthase subunit alpha
- MTBC0 PGAP product: tryptophan synthase subunit alpha
- Pfam (hmmscan --cut_ga): Trp_syntA PF00290.27 (E=8e-68)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216129.1)
- Domains: Pfam-A via hmmscan --cut_ga — Trp_syntA (PF00290.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0159 - Curated reference: UniProt P9WFY1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
108 functional partner(s); context anchor
trpC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001719|Rv1613|trpA MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFVYAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGSALVTALTEGLPRLRALTGELAAGVRLGMSA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for trpA? Email the maintainer — the message is pre-filled with this gene's details.