Rv1610 Family assigned · medium auto-curated

H37Rv Rv1610 · MTBC0 mtbc0_001716 · 235 aa · 1821407–1822114 (+) · RefSeq NP_216126.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationTIGR02234 family membrane protein
Revised (this work)TIGR02234 family membrane protein. Pfam: Trp_oprn_chp (PF09534.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06128 TrEMBL · unreviewed · Predicted
UniProt namePossible conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionTrp region conserved
Orthologous group2EGC7

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.758 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Trp_oprn_chpPF09534.16 1.0e-4323–224 Tryptophan-associated transmembrane protein (Trp_oprn_chp)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trpE (anthranilate synthase component I), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1609 trpE anthranilate synthase component I 884 884 ctx neighborhood:881
Rv1611 trpC indole-3-glycerol phosphate synthase 781 781 ctx neighborhood:778
Rv1608c bcpB peroxiredoxin 773 773 ctx neighborhood:773
Rv1125 hyp hypothetical protein 766 766 ctx cooccurence:764
Rv3843c transmembrane protein 763 763 ctx cooccurence:760
Rv0383c ttfA hyp hypothetical protein 761 761 ctx cooccurence:761
Rv1274 lprB lipoprotein LprB 755 755 ctx cooccurence:754
Rv0817c lmeA hyp hypothetical protein 752 753 ctx cooccurence:752
Rv3850 hyp hypothetical protein 750 751 ctx cooccurence:747
Rv3802c membrane protein 748 749 ctx cooccurence:747
Rv1100 hyp hypothetical protein 747 748 ctx cooccurence:746
Rv3035 hyp hypothetical protein 747 748 ctx cooccurence:744
Rv1275 lprC lipoprotein LprC 746 747 ctx cooccurence:745
Rv2342 hyp hypothetical protein 741 741 ctx cooccurence:740
Rv3794 embA arabinosyltransferase A 739 740 ctx cooccurence:733

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: TIGR02234 family membrane protein
  • Pfam (hmmscan --cut_ga): Trp_oprn_chp PF09534.16 (E=1e-43)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216126.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Trp_oprn_chp (PF09534.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EGC7
  • Curated reference: UniProt O06128 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 113 functional partner(s); context anchor trpE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001716|Rv1610|
MAANAGSVRPNRRARPMIGIAQLLLVVAAGALWMAARLPWVVIGSFDELGPPKEVTLTGASWSTALLPLALLMLAAAVAALAVRGWPLRALAVLLAAASFAVGYLGISLWVVPDVAARGADLAHVPVVTLVGSARHYWGAVAAVLAAVCALLAAVFLMSSAAIRGSAGEDMARYAAPRARRSIARRQHSNAAGRAAPQDDGPDMGPRMSERMIWEALDEGRDPTDREQESDTEGR