hisI Resolved · high auto-curated
H37Rv Rv1606 · MTBC0 mtbc0_001712 ·
115 aa · 1817617–1817964 (+) ·
RefSeq NP_216638.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phosphoribosyl-AMP cyclohydrolase |
|---|---|
| MTBC0 PGAP re-annotation | phosphoribosyl-AMP cyclohydrolase |
| Revised (this work) | Phosphoribosyl-AMP cyclohydrolase. Pfam: PRA-CH (PF01502.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WMM7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phosphoribosyl-AMP cyclohydrolase |
| EC (curated) |
EC 3.5.4.19
|
| Curated function | Catalyzes the hydrolysis of the adenine ring of phosphoribosyl-AMP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | hisI |
| eggNOG description | Catalyzes the hydrolysis of the adenine ring of phosphoribosyl-AMP |
| Orthologous group | COG0139 |
| EC number |
EC 3.5.4.19, EC 3.6.1.31
|
| KEGG orthology |
K01496, K11755
|
| KEGG pathways |
map00340, map01100, map01110, map01230
|
| KEGG modules |
M00026
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.955 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PRA-CH | PF01502.24 | 1.4e-34 | 33–105 | Phosphoribosyl-AMP cyclohydrolase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: hisA (1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1603 hisA |
1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 999 | 1000 ctx | neighborhood:881 fusion:889 cooccurence:769 coexpression:968 database:900 textmining:590 |
Rv1602 hisH |
imidazole glycerol phosphate synthase subunit HisH | 998 | 998 ctx | neighborhood:876 cooccurence:773 coexpression:926 textmining:492 |
Rv1601 hisB |
imidazole glycerol-phosphate dehydratase | 999 | 997 ctx | neighborhood:876 cooccurence:774 coexpression:887 textmining:759 |
Rv1605 hisF |
imidazole glycerol phosphate synthase subunit HisF | 999 | 997 ctx | neighborhood:881 cooccurence:774 coexpression:910 textmining:695 |
Rv1599 hisD |
histidinol dehydrogenase | 999 | 996 ctx | neighborhood:876 cooccurence:774 coexpression:865 textmining:848 |
Rv2122c hisE |
phosphoribosyl-ATP pyrophosphatase | 992 | 990 | coexpression:857 database:900 |
Rv1600 hisC1 |
histidinol-phosphate aminotransferase | 996 | 988 ctx | neighborhood:876 cooccurence:668 coexpression:740 textmining:692 |
Rv1604 impA |
inositol-monophosphatase ImpA | 978 | 977 ctx | neighborhood:881 coexpression:817 |
Rv2121c hisG |
ATP phosphoribosyltransferase | 983 | 968 ctx | cooccurence:749 coexpression:857 textmining:516 |
Rv3772 hisC2 |
histidinol-phosphate aminotransferase | 805 | 785 | coexpression:694 |
Rv2231c cobC |
aminotransferase | 792 | 770 | coexpression:695 |
Rv3859c gltB |
glutamate synthase large subunit | 736 | 656 ctx | neighborhood:544 |
Rv1598c hyp |
hypothetical protein | 555 | 555 ctx | neighborhood:553 |
Rv1613 trpA |
tryptophan synthase subunit alpha | 600 | 554 | coexpression:445 |
Rv1612 trpB |
tryptophan synthase subunit beta | 576 | 554 | coexpression:445 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: phosphoribosyl-AMP cyclohydrolase
- MTBC0 PGAP product: phosphoribosyl-AMP cyclohydrolase
- Pfam (hmmscan --cut_ga): PRA-CH PF01502.24 (E=1e-34)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216638.2)
- Domains: Pfam-A via hmmscan --cut_ga — PRA-CH (PF01502.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0139 - Curated reference: UniProt P9WMM7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
70 functional partner(s); context anchor
hisA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001712|Rv1606|hisI MTLDPKIAARLKRNADGLVTAVVQERGSGDVLMVAWMNDEALARTLQTREATYYSRSRAEQWVKGATSGHTQHVHSVRLDCDGDAVLLTVDQVGGACHTGDHSCFDAAVLLEPDD