ahpC Resolved · high auto-curated

H37Rv Rv2428 · MTBC0 mtbc0_002586 · 195 aa · 2750441–2751028 (+) · RefSeq NP_216944.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)alkyl hydroperoxide reductase subunit AhpC
MTBC0 PGAP re-annotationperoxiredoxin AhpC
Revised (this work)Peroxiredoxin AhpC. Pfam: AhpC-TSA (PF00578.28), Redoxin (PF08534.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQB7 SwissProt · reviewed · Evidence at protein level
UniProt nameAlkyl hydroperoxide reductase C
EC (curated) EC 1.11.1.28
Curated functionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Together with AhpD, DlaT and Lpd, constitutes an NADH-dependent peroxidase active against hydrogen and alkyl peroxides as well as serving as a peroxynitrite reductase, thus protecting the bacterium against reactive nitrogen intermediates and oxidative stress generated by the host immune system. Does not however seem to play a role in detoxification of isoniazid.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameahpC
eggNOG descriptionAlkyl hydroperoxide reductase
Orthologous groupCOG0450
EC number EC 1.11.1.15
KEGG orthology K03386
KEGG pathways map04214
Gene Ontology (77) GO:0003674, GO:0003824, GO:0004601, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006950, GO:0008150 +65 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.401 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AhpC-TSAPF00578.28 5.7e-3427–146 AhpC/TSA family
RedoxinPF08534.17 6.4e-1332–155 Redoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ahpD (alkyl hydroperoxide reductase AphD), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2429 ahpD alkyl hydroperoxide reductase AphD 999 994 ctx neighborhood:844 cooccurence:766 coexpression:837 textmining:902
Rv3913 trxB2 thioredoxin reductase 955 896 coexpression:437 experimental:808 textmining:588
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 873 834 experimental:468 database:611
Rv1677 dsbF lipoprotein DsbF 882 831 experimental:468 database:611
Rv0816c thiX thioredoxin ThiX 868 831 experimental:468 database:611
Rv3673c membrane-anchored thioredoxin-like protein 841 831 experimental:468 database:611
Rv2878c mpt53 soluble secreted antigen Mpt53 843 830 experimental:468 database:611
Rv0526 thioredoxin 840 830 experimental:468 database:611
Rv2359 zur zinc uptake regulation protein 645 598 coexpression:575
Rv1909c furA ferric uptake regulation protein FurA 870 596 coexpression:573 textmining:692
Rv3841 bfrB bacterioferritin BfrB 664 595 coexpression:562
Rv1875 hyp hypothetical protein 588 589 ctx neighborhood:521
Rv0440 groEL2 molecular chaperone GroEL 661 576
Rv3417c groEL1 chaperonin GroEL 626 576
Rv2521 bcp peroxiredoxin 590 557 ctx cooccurence:467

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: alkyl hydroperoxide reductase subunit AhpC
  • MTBC0 PGAP product: peroxiredoxin AhpC
  • Pfam (hmmscan --cut_ga): AhpC-TSA PF00578.28 (E=6e-34), Redoxin PF08534.17 (E=6e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216944.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AhpC-TSA (PF00578.28), Redoxin (PF08534.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0450
  • Curated reference: UniProt P9WQB7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 128 functional partner(s); context anchor ahpD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002586|Rv2428|ahpC
MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEVLRVLDALQSDELCACNWRKGDPTLDAGELLKASA