ahpC Resolved · high auto-curated
H37Rv Rv2428 · MTBC0 mtbc0_002586 ·
195 aa ·
2750441–2751028 MTBC0
(+) ·
RefSeq NP_216944.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | alkyl hydroperoxide reductase subunit AhpC |
|---|---|
| MTBC0 PGAP re-annotation | peroxiredoxin AhpC |
| Revised (this work) | Peroxiredoxin AhpC. Pfam: AhpC-TSA (PF00578.28), Redoxin (PF08534.17). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 252 publications
252 TB publications mention this gene. 252 publication(s) discuss this gene (237 in a M. tuberculosis context, 27 in other mycobacteria — M. smegmatis (20), M. leprae (6), M. marinum (4), M. abscessus (1)).
| Publication | Date |
|---|---|
| Evaluation of the laboratory performance of MolecuTech®REBA MTB-MDR kit for the detection of multidrug resistant tuberculosis. doi:10.1016/j.jctube.2026.100616 | 2026 |
| Association of katG, inhA, and AhpC Mutations with Isoniazid Resistance of Mycobacterium tuberculosis in Pulmonary Tuberculosis Patients from Nanjing, China. doi:10.1177/10766294261446052 | 2026 |
| The performance of the WHO mutation catalog of Mycobacterium tuberculosis in the diagnosis of drug resistance to rifampicin-resistant strains in Wenzhou, China. doi:10.1128/spectrum.02481-25 | 2026 |
| Mutations in oxyR and oxyR-ahpC Interogenic Region in Isoniazid-Resistant Mycobacterium tuberculosis Clinical Isolates from Chongqing, China. doi:10.2147/IDR.S562591 | 2026 |
| Prevalence and resistance spectrum of ahpC mutations in isoniazid-resistant Mycobacterium tuberculosis isolates. doi:10.1128/spectrum.02496-25 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Fumarate Reductase.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.28 (95% CI -0.35 to 3.90). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in oxidative stress response. LPDC|Rv0462, DLAT|Rv2215, AHPD|Rv2429, and AHPC|Rv2428 constitute an NADH-dependent peroxidase and peroxynitrite reductase that provides protection against oxidative stress. |
|---|---|
| Mycobrowser EC |
1.11.1.15
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2454
· 100.0% identity |
|---|---|
| M. leprae |
ML2042
· 86.7% identity |
| M. marinum |
MMAR_2755
· 91.8% identity |
| M. smegmatis |
MSMEG_4891
· 82.2% identity |
| M. orygis |
RJtmp_002511
· 100.0% identity |
| M. abscessus |
MAB_4408c
· 83.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQB7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Alkyl hydroperoxide reductase C |
| EC (curated) |
EC 1.11.1.28
|
| Curated function | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Together with AhpD, DlaT and Lpd, constitutes an NADH-dependent peroxidase active against hydrogen and alkyl peroxides as well as serving as a peroxynitrite reductase, thus protecting the bacterium against reactive nitrogen intermediates and oxidative stress generated by the host immune system. Does not however seem to play a role in detoxification of isoniazid. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | ahpC |
| eggNOG description | Alkyl hydroperoxide reductase |
| Orthologous group | COG0450 |
| EC number |
EC 1.11.1.15
|
| KEGG orthology |
K03386
|
| KEGG pathways |
map04214
|
| Gene Ontology (77) |
GO:0003674, GO:0003824, GO:0004601, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006950, GO:0008150 +65 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.401 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 87.2%
· 3/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 54.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 40.2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Isoniazid (drug exposure) | -4.74 | 0.0 | required |
| altered fitness under Isoniazid (drug exposure) | -3.90 | 0.013 | required |
| fitness in mouse infection (in vivo) | +2.52 | 0.0063 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 666.0 ppm · rank 325/3519 (90.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 195 aa |
|---|---|
| Molecular weight | 21.6 kDa |
| Theoretical pI | 4.5 |
| GRAVY | -0.163 (hydrophilic) |
| Aliphatic index | 86.6 |
| Aromaticity | 0.097 |
| Instability index | 28.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AhpC-TSA | PF00578.28 | 5.7e-34 | 27–146 | AhpC/TSA family |
Redoxin | PF08534.17 | 6.4e-13 | 32–155 | Redoxin |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2bmx |
X-ray diffraction | 2.4 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7bz6-assembly1_B |
1.00 | 0.95 | 6.8e-36 sig | 7bz6-assembly1_B Mycobacterium bovis AhpC |
2bmx-assembly1_B |
1.00 | 0.95 | 6.4e-35 sig | 2bmx-assembly1_B Mycobacterium tuberculosis AhpC |
2bmx-assembly1_A |
1.00 | 0.96 | 4.3e-34 sig | 2bmx-assembly1_A Mycobacterium tuberculosis AhpC |
7bz6-assembly1_A |
1.00 | 0.96 | 1.2e-33 sig | 7bz6-assembly1_A Mycobacterium bovis AhpC |
7kiz-assembly1_B |
1.00 | 0.86 | 4.9e-21 sig | 7kiz-assembly1_B reduced human peroxiredoxin 2 |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | proA (- strand, 715 bp gap) |
|---|---|
| Downstream (3' on genome) | ahpD (+ strand, 25 bp gap) |
| Predicted operon |
ahpC · ahpD
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv0047c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: ahpD (alkyl hydroperoxide reductase AphD), high confidence from genomic context alone (score 994 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2429 ahpD |
alkyl hydroperoxide reductase AphD | 999 | 994 ctx | neighborhood:844 cooccurence:766 coexpression:837 textmining:902 |
Rv3913 trxB2 exp |
thioredoxin reductase | 955 | 896 | coexpression:437 experimental:808 textmining:588 |
Rv2874 dipZ exp |
integral membrane C-type cytochrome biogenesis protein DipZ | 873 | 834 | experimental:468 database:611 |
Rv1677 dsbF exp |
lipoprotein DsbF | 882 | 831 | experimental:468 database:611 |
Rv0816c thiX exp |
thioredoxin ThiX | 868 | 831 | experimental:468 database:611 |
Rv3673c exp |
membrane-anchored thioredoxin-like protein | 841 | 831 | experimental:468 database:611 |
Rv2878c mpt53 exp |
soluble secreted antigen Mpt53 | 843 | 830 | experimental:468 database:611 |
Rv0526 exp |
thioredoxin | 840 | 830 | experimental:468 database:611 |
Rv2359 zur |
zinc uptake regulation protein | 645 | 598 | coexpression:575 |
Rv1909c furA |
ferric uptake regulation protein FurA | 870 | 596 | coexpression:573 textmining:692 |
Rv3841 bfrB |
bacterioferritin BfrB | 664 | 595 | coexpression:562 |
Rv1875 hyp |
hypothetical protein | 588 | 589 ctx | neighborhood:521 |
Rv0440 groEL2 |
molecular chaperone GroEL | 661 | 576 | |
Rv3417c groEL1 |
chaperonin GroEL | 626 | 576 | |
Rv2521 bcp |
peroxiredoxin | 590 | 557 ctx | cooccurence:467 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: alkyl hydroperoxide reductase subunit AhpC
- MTBC0 PGAP product: peroxiredoxin AhpC
- Pfam (hmmscan --cut_ga): AhpC-TSA PF00578.28 (E=6e-34), Redoxin PF08534.17 (E=6e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216944.1)
- Domains: Pfam-A via hmmscan --cut_ga — AhpC-TSA (PF00578.28), Redoxin (PF08534.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0450 - Curated reference: UniProt P9WQB7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
128 functional partner(s); context anchor
ahpD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002586|Rv2428|ahpC MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEVLRVLDALQSDELCACNWRKGDPTLDAGELLKASA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ahpC? Email the maintainer — the message is pre-filled with this gene's details.