Rv1615 Family assigned · medium auto-curated

H37Rv Rv1615 · MTBC0 mtbc0_001722 · 146 aa · 1827217–1827657 (+) · RefSeq NP_216131.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationTM2 domain-containing protein
Revised (this work)TM2 domain-containing protein. Pfam: TM2 (PF05154.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06132 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionmembrane
Orthologous groupCOG2314

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.368 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TM2PF05154.22 9.0e-1172–125 TM2 domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pykA (pyruvate kinase), medium confidence from genomic context alone (score 597 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1616 hyp hypothetical protein 882 882 ctx neighborhood:882
Rv1617 pykA pyruvate kinase 597 597 ctx neighborhood:597
Rv1618 tesB1 acyl-CoA thioesterase II 594 594 ctx neighborhood:594
Rv2360c hyp hypothetical protein 539 539 ctx cooccurence:539
Rv2468c hyp hypothetical protein 507 507 ctx cooccurence:507
Rv2709 transmembrane protein 460 460 ctx cooccurence:460
Rv3415c hyp hypothetical protein 437 437 ctx cooccurence:437
Rv0312 hyp hypothetical protein 434 434 ctx cooccurence:434
Rv1619 hyp hypothetical protein 430 430 ctx neighborhood:430
Rv1638A hyp hypothetical protein 414 414 ctx cooccurence:414

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: TM2 domain-containing protein
  • Pfam (hmmscan --cut_ga): TM2 PF05154.22 (E=9e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216131.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TM2 (PF05154.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2314
  • Curated reference: UniProt O06132 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor pykA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001722|Rv1615|
MGLRPARVVRPARSGMLKGVTDPLQHGAFEPGWQSAPPGYPPPYPQYPGPGSYFDPFAPYGRHPVTGQPFSDKSKTVAGLLQLLGLFGIAGIGRIYLGHTGLGIAQLLVGWVTCGLGAVIWGVIDALLILTDKVGDPWGRPLRDGS