ahpE Resolved · high auto-curated
H37Rv Rv2238c · MTBC0 mtbc0_002380 ·
153 aa · 2536873–2537334 (-) ·
RefSeq NP_216754.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | peroxiredoxin |
|---|---|
| MTBC0 PGAP re-annotation | peroxiredoxin AhpE |
| Revised (this work) | Peroxiredoxin AhpE. Pfam: AhpC-TSA (PF00578.28), Redoxin (PF08534.17). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIE3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Alkyl hydroperoxide reductase E |
| EC (curated) |
EC 1.11.1.29
|
| Curated function | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May represent an important antioxidant defense against cytotoxic peroxides, especially peroxynitrite, which can be formed by activated macrophages during infection. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | ahpE |
| eggNOG description | Peroxiredoxin |
| Orthologous group | COG1225 |
| EC number |
EC 1.11.1.15
|
| KEGG orthology |
K03386
|
| KEGG pathways |
map04214
|
| Gene Ontology (55) |
GO:0003674, GO:0003824, GO:0004601, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0008150, GO:0008152, GO:0009605 +43 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AhpC-TSA | PF00578.28 | 1.3e-33 | 4–129 | AhpC/TSA family |
Redoxin | PF08534.17 | 2.2e-18 | 4–134 | Redoxin |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: aceE (pyruvate dehydrogenase E1 component), medium confidence from genomic context alone (score 625 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2239c hyp |
hypothetical protein | 972 | 912 ctx | neighborhood:882 textmining:699 |
Rv2240c hyp |
hypothetical protein | 927 | 836 ctx | neighborhood:829 textmining:573 |
Rv1611 trpC |
indole-3-glycerol phosphate synthase | 724 | 725 | coexpression:716 |
Rv2241 aceE |
pyruvate dehydrogenase E1 component | 638 | 625 ctx | neighborhood:551 |
Rv1630 rpsA |
30S ribosomal protein S1 | 616 | 615 | coexpression:560 |
Rv1614 lgt |
prolipoprotein diacylglyceryl transferase | 614 | 597 | coexpression:584 |
Rv2237A hyp |
hypothetical protein | 503 | 503 ctx | neighborhood:503 |
Rv0178 |
Mce associated membrane protein | 493 | 494 | coexpression:429 |
Rv0175 |
Mce associated membrane protein | 457 | 458 | coexpression:458 |
Rv2242 hyp |
hypothetical protein | 417 | 418 ctx | neighborhood:412 |
Rv2428 ahpC |
alkyl hydroperoxide reductase subunit AhpC | 530 | 403 | |
Rv1608c bcpB |
peroxiredoxin | 566 | 283 | textmining:420 |
Rv3198A |
glutaredoxin protein | 454 | 190 | |
Rv2874 dipZ |
integral membrane C-type cytochrome biogenesis protein DipZ | 718 | 168 | textmining:676 |
Rv2877c |
integral membrane protein | 831 | 134 | textmining:813 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: peroxiredoxin
- MTBC0 PGAP product: peroxiredoxin AhpE
- Pfam (hmmscan --cut_ga): AhpC-TSA PF00578.28 (E=1e-33), Redoxin PF08534.17 (E=2e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216754.1)
- Domains: Pfam-A via hmmscan --cut_ga — AhpC-TSA (PF00578.28), Redoxin (PF08534.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1225 - Curated reference: UniProt P9WIE3 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
aceE - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002380|Rv2238c|ahpE MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA