ahpE Resolved · high auto-curated

H37Rv Rv2238c · MTBC0 mtbc0_002380 · 153 aa · 2536873–2537334 (-) · RefSeq NP_216754.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peroxiredoxin
MTBC0 PGAP re-annotationperoxiredoxin AhpE
Revised (this work)Peroxiredoxin AhpE. Pfam: AhpC-TSA (PF00578.28), Redoxin (PF08534.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIE3 SwissProt · reviewed · Evidence at protein level
UniProt nameAlkyl hydroperoxide reductase E
EC (curated) EC 1.11.1.29
Curated functionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May represent an important antioxidant defense against cytotoxic peroxides, especially peroxynitrite, which can be formed by activated macrophages during infection.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameahpE
eggNOG descriptionPeroxiredoxin
Orthologous groupCOG1225
EC number EC 1.11.1.15
KEGG orthology K03386
KEGG pathways map04214
Gene Ontology (55) GO:0003674, GO:0003824, GO:0004601, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0008150, GO:0008152, GO:0009605 +43 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AhpC-TSAPF00578.28 1.3e-334–129 AhpC/TSA family
RedoxinPF08534.17 2.2e-184–134 Redoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aceE (pyruvate dehydrogenase E1 component), medium confidence from genomic context alone (score 625 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2239c hyp hypothetical protein 972 912 ctx neighborhood:882 textmining:699
Rv2240c hyp hypothetical protein 927 836 ctx neighborhood:829 textmining:573
Rv1611 trpC indole-3-glycerol phosphate synthase 724 725 coexpression:716
Rv2241 aceE pyruvate dehydrogenase E1 component 638 625 ctx neighborhood:551
Rv1630 rpsA 30S ribosomal protein S1 616 615 coexpression:560
Rv1614 lgt prolipoprotein diacylglyceryl transferase 614 597 coexpression:584
Rv2237A hyp hypothetical protein 503 503 ctx neighborhood:503
Rv0178 Mce associated membrane protein 493 494 coexpression:429
Rv0175 Mce associated membrane protein 457 458 coexpression:458
Rv2242 hyp hypothetical protein 417 418 ctx neighborhood:412
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 530 403
Rv1608c bcpB peroxiredoxin 566 283 textmining:420
Rv3198A glutaredoxin protein 454 190
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 718 168 textmining:676
Rv2877c integral membrane protein 831 134 textmining:813

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peroxiredoxin
  • MTBC0 PGAP product: peroxiredoxin AhpE
  • Pfam (hmmscan --cut_ga): AhpC-TSA PF00578.28 (E=1e-33), Redoxin PF08534.17 (E=2e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216754.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AhpC-TSA (PF00578.28), Redoxin (PF08534.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1225
  • Curated reference: UniProt P9WIE3 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor aceE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002380|Rv2238c|ahpE
MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA