rubB Resolved · high auto-curated

H37Rv Rv3250c · MTBC0 mtbc0_003458 · 60 aa · 3652527–3652709 (-) · RefSeq NP_217767.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)rubredoxin RubB
MTBC0 PGAP re-annotationrubredoxin RubB
Revised (this work)Rubredoxin RubB. Pfam: Rubredoxin (PF00301.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YFL7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameRubredoxin
Curated functionInvolved in the hydrocarbon hydroxylating system, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namerubB
eggNOG descriptioninvolved in the hydrocarbon hydroxylating system to convert conversion of dodecane to lauric acid, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase
Orthologous groupCOG1773

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RubredoxinPF00301.26 6.5e-227–52 Rubredoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rubA (rubredoxin RubA), high confidence from genomic context alone (score 958 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3251c rubA rubredoxin RubA 960 958 ctx neighborhood:816 coexpression:759
Rv3252c alkB transmembrane alkane 1-monooxygenase AlkB 969 943 ctx neighborhood:882 coexpression:460 textmining:482
Rv3249c TetR family transcriptional regulator 922 910 ctx neighborhood:881
Rv3253c cationic amino acid transport integral membrane protein 769 769 ctx neighborhood:768
Rv1869c reductase 746 731 coexpression:408 experimental:549
Rv0688 ferredoxin reductase 746 731 coexpression:408 experimental:549
Rv0252 nirB nitrite reductase large subunit NirB 745 729 coexpression:404 experimental:549
Rv3248c sahH adenosylhomocysteinase 647 647 ctx neighborhood:642
Rv3247c tmk thymidylate kinase 480 479 ctx neighborhood:479
Rv3841 bfrB bacterioferritin BfrB 475 449 coexpression:417
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 483 414
Rv3246c mtrA two component DNA-binding response regulator MtrA 416 394
Rv3254 hyp hypothetical protein 406 384
Rv2359 zur zinc uptake regulation protein 410 375
Rv1909c furA ferric uptake regulation protein FurA 410 375

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: rubredoxin RubB
  • MTBC0 PGAP product: rubredoxin RubB
  • Pfam (hmmscan --cut_ga): Rubredoxin PF00301.26 (E=7e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217767.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rubredoxin (PF00301.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1773
  • Curated reference: UniProt I6YFL7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor rubA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003458|Rv3250c|rubB
MNDYKLFRCIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKSDFEMVEVARS