Rv3750c Resolved · high auto-curated

H37Rv Rv3750c · MTBC0 - · 130 aa · 4198205–4198597 (-) · RefSeq NP_218267.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)excisionase
MTBC0 PGAP re-annotation
Revised (this work)Excisionase. Pfam: HTH_17 (PF12728.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O69717 SwissProt · reviewed · Predicted
UniProt namePutative antitoxin VapB50
Curated functionPossibly the antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC50.

UniProt still lists this protein as Putative antitoxin VapB50; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionHelix-turn-helix domain
Orthologous groupCOG3311

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.354 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_17PF12728.14 8.6e-1555–103 Helix-turn-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3751 (Rv3751, (MTV025.099), len: 71 aa. Probable integrase (fragment), similar to part of many e.g. Q48908 integrase (fragment) from Mycobacterium), medium confidence from genomic context alone (score 448 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3749c vapC50 hyp hypothetical protein 994 962 ctx neighborhood:786 cooccurence:774 textmining:853
Rv3751 Rv3751, (MTV025.099), len: 71 aa. Probable integrase (fragment), similar to part of many e.g. Q48908 integrase (fragment) from Mycobacterium 476 448 ctx neighborhood:446
Rv2018 vapB45 hyp hypothetical protein 573 281 textmining:431
Rv1246c relE toxin RelE 452 264
Rv2022c higB2 hyp hypothetical protein 607 170 textmining:547
Rv3182 higB3 hyp hypothetical protein 679 169 textmining:630
Rv0065 vapC1 ribonuclease VapC1 407 162
Rv2021c higA2 transcriptional regulator 595 110 textmining:564
Rv3183 higA3 transcriptional regulator 589 105 textmining:560
Rv1765c hyp hypothetical protein 493 63 textmining:481
Rv0299 toxin 804 50 textmining:803
Rv0298 antitoxin 806 47 textmining:805
Rv3181c vapB49 antitoxin VapB45 437 47 textmining:434
Rv1584c phage protein 698 46 textmining:697
Rv3697c vapC48 ribonuclease VapC48 523 45 textmining:522

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): excisionase
  • Pfam (hmmscan --cut_ga): HTH_17 PF12728.14 (E=9e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218267.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_17 (PF12728.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3311
  • Curated reference: UniProt O69717 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor Rv3751
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3750c|
MTSLLEVLGAPEVSVCGNAGQPMTLPEPVRDALYNVVLALSQGKGISLVPRHLKLTTQEAADLLNISRPTLVRLLEDGRIPFEKPGRHRRVSLDALLEYQQETRSNRRAALGELSRDALGELQAALAEKK