Rv1480 Family assigned · low

H37Rv Rv1480 · MTBC0 mtbc0_001583 · 317 aa · 1680218–1681171 (+) · RefSeq NP_215996.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF58 domain-containing protein
Revised (this work)DUF58; fold of the BatB/DUF58 family (PDB 3IBS); putative integrity/assembly protein.

Curated reference (UniProt)

UniProt P9WLX5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1480

UniProt still lists this protein as Uncharacterized protein Rv1480; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionconserved protein (some members contain a von Willebrand factor type A (vWA) domain)
Orthologous groupCOG1721
Gene Ontology (13) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044424, GO:0044444, GO:0044464 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.15 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF58PF01882.26 8.2e-8561–275 Protein of unknown function DUF58

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 89.5 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3ibs-assembly1_B 1.00 0.61 3.2e-07 sig 3ibs-assembly1_B Crystal structure of conserved hypothetical protein BatB from Bacteroides thetaiotaomicron
4jdu-assembly1_A 1.00 0.56 2.5e-06 sig 4jdu-assembly1_A The crystal structure of an aerotolerance-related membrane protein from Bacteroides fragilis NCTC 9343 with multiple mutations to serines.
8ft6-assembly1_A 1.00 0.65 3.1e-04 sig 8ft6-assembly1_A The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, SUMO tag-free preparation.
8zmn-assembly1_A 1.00 0.61 1.7e-04 sig 8zmn-assembly1_A Crystal structure of ANTXR1
8jtl-assembly1_B 1.00 0.57 1.6e-04 sig 8jtl-assembly1_B Structure of OY phytoplasma SAP05 binding with AtRpn10
8j4a-assembly1_B 1.00 0.55 1.0e-04 sig 8j4a-assembly1_B Crystal structure of OY phytoplasma SAP05 in complex with AtRPN10
8amz-assembly1_W 1.00 0.59 5.1e-04 sig 8amz-assembly1_W Spinach 19S proteasome
5oqm-assembly1_6 1.00 0.46 2.2e-04 sig 5oqm-assembly1_6 STRUCTURE OF YEAST TRANSCRIPTION PRE-INITIATION COMPLEX WITH TFIIH AND CORE MEDIATOR

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1481 (membrane protein), high confidence from genomic context alone (score 994 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1481 membrane protein 994 994 ctx neighborhood:874 cooccurence:774 coexpression:819
Rv1479 moxR1 transcriptional regulator MoxR1 986 984 ctx neighborhood:882 cooccurence:742 coexpression:414
Rv3164c moxR3 methanol dehydrogenase transcriptional regulator MoxR 667 613 ctx cooccurence:448
Rv3692 moxR2 methanol dehydrogenase transcriptional regulator MoxR 648 591 ctx cooccurence:433
Rv1477 ripA peptidoglycan endopeptidase RipA 587 587 ctx neighborhood:576
Rv2902c rnhB ribonuclease HII 586 587 coexpression:580
Rv1478 ripB peptidoglycan endopeptidase RipB 573 573 ctx neighborhood:563
Rv1484 inhA NADH-dependent enoyl-[ACP 554 554 ctx neighborhood:544
Rv1485 hemZ ferrochelatase 550 551 ctx neighborhood:544
Rv1483 fabG1 3-oxoacyl-ACP reductase FabG 550 551 ctx neighborhood:544
Rv0049 hyp hypothetical protein 408 409 ctx cooccurence:405
Rv1474c transcriptional regulator 404 404
Rv2468c hyp hypothetical protein 406 390
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 438 87 textmining:411
Rv3680 anion transporter ATPase 742 64 textmining:736

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: DUF58 domain-containing protein
  • Pfam: DUF58 PF01882.26
  • Foldseek best: 3ibs-assembly1_B Crystal structure of conserved hypothetical protein BatB from B (prob 1.00, E=3e-07, TM=0.61)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215996.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF58 (PF01882.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1721
  • Curated reference: UniProt P9WLX5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 89.5, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv1481
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001583|Rv1480|
MTESKAPAVVHPPSMLRGDIDDPKLAAALRTLELTVKQKLDGVLHGDHLGLIPGPGSEPGESRLYQPGDDVRRMDWAVTARTTHPHVRQMIADRELETWLVVDMSASLDFGTACCEKRDLAVAAAAAITFLNSGGGNRLGALIANGAAMTRVPARTGRQHQHTMLRTIATMPQAPAGVRGDLAVAIDALRRPERRRGMAVIISDFLGPINWMRPLRAIAARHEVLAIEVLDPRDVELPDVGDVVLQDAESGVVREFSIDPALRDDFARAAAAHRADVARTIRGCGAPLLSLRTDRDWLADIVRFVASRRRGALAGHQ