Rv1488 Family assigned · medium auto-curated

H37Rv Rv1488 · MTBC0 mtbc0_001591 · 381 aa · 1687202–1688347 (+) · RefSeq NP_216004.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSPFH domain-containing protein
Revised (this work)SPFH domain-containing protein. Pfam: Band_7 (PF01145.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPR9 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1488

UniProt still lists this protein as Uncharacterized protein Rv1488; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namehflK
eggNOG descriptionCOG0330 Membrane protease subunits, stomatin prohibitin homologs
Orthologous groupCOG0330
Gene Ontology (9) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.262 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.14% of strains (203) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Band_7PF01145.32 1.9e-3729–207 SPFH domain / Band 7 family

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1487 hyp hypothetical protein 973 971 ctx neighborhood:851 cooccurence:750
Rv3610c ftsH zinc metalloprotease FtsH 963 959 coexpression:467 experimental:805 database:633
Rv1489 hyp hypothetical protein 878 879 ctx neighborhood:828
Rv0038 hyp hypothetical protein 805 806 coexpression:804
Rv2115c mpa proteasome-associated ATPase 821 804 coexpression:779
Rv1110 lytB2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 783 783 coexpression:783
Rv1486c hyp hypothetical protein 777 777 ctx neighborhood:767
Rv1019 transcriptional regulator 765 765 coexpression:765
Rv1100 hyp hypothetical protein 757 757 coexpression:757
Rv2782c pepR zinc protease 778 751 database:594
Rv2867c GCN5-like N-acetyltransferase 748 748 coexpression:740
Rv2788 sirR transcriptional repressor SirR 734 734 coexpression:734
Rv0903c prrA two component transcriptional regulator PrrA 733 734 coexpression:734
Rv1337 integral membrane protein 704 678 database:619
Rv0110 integral membrane protein 698 672 database:619

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SPFH domain-containing protein
  • Pfam (hmmscan --cut_ga): Band_7 PF01145.32 (E=2e-37)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216004.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Band_7 (PF01145.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0330
  • Curated reference: UniProt P9WPR9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001591|Rv1488|
MQGAVAGLVFLAVLVIFAIIVVAKSVALIPQAEAAVIERLGRYSRTVSGQLTLLVPFIDRVRARVDLRERVVSFPPQPVITEDNLTLNIDTVVYFQVTVPQAAVYEISNYIVGVEQLTTTTLRNVVGGMTLEQTLTSRDQINAQLRGVLDEATGRWGLRVARVELRSIDPPPSIQASMEKQMKADREKRAMILTAEGTREAAIKQAEGQKQAQILAAEGAKQAAILAAEADRQSRMLRAQGERAAAYLQAQGQAKAIEKTFAAIKAGRPTPEMLAYQYLQTLPEMARGDANKVWVVPSDFNAALQGFTRLLGKPGEDGVFRFEPSPVEDQPKHAADGDDAEVAGWFSTDTDPSIARAVATAEAIARKPVEGSLGTPPRLTQ