espR Family assigned · low auto-curated

H37Rv Rv3849 · MTBC0 mtbc0_004082 · 132 aa · 4347609–4348007 (+) · RefSeq NP_218366.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-1 transcriptional regulator EspR
MTBC0 PGAP re-annotationtype VII secretion system ESX-1 transcriptional regulator EspR
Revised (this work)Type VII secretion system ESX-1 transcriptional regulator EspR.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJB7 SwissProt · reviewed · Evidence at protein level
UniProt nameNucleoid-associated protein EspR
Curated functionVirulence regulator that has both architectural and regulatory roles. Impacts cell wall functions and pathogenesis through regulation of multiple genes, including the espACD operon, which is a key ESX-1 component. Influences target gene expression positively or negatively, depending on its binding position relative to the genes it controls. Acts by binding directly to the DNA. May play a central role in regulating virulence gene expression.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameespR
eggNOG descriptiontranscriptional regulators
Orthologous groupCOG1476
Gene Ontology (68) GO:0002791, GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005622, GO:0005623, GO:0005737 +56 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0882 (transmembrane protein), medium confidence from genomic context alone (score 682 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3850 hyp hypothetical protein 854 813 ctx neighborhood:712
Rv0882 transmembrane protein 681 682 ctx cooccurence:680
Rv3647c hyp hypothetical protein 673 673 ctx cooccurence:668
Rv1109c hyp hypothetical protein 662 663 ctx cooccurence:652
Rv2091c membrane protein 613 613 ctx cooccurence:593
Rv1222 rseA anti-sigma E factor RseA 623 608 ctx cooccurence:598
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 615 601 ctx cooccurence:598
Rv0481c hyp hypothetical protein 596 597 ctx cooccurence:593
Rv3822 chp1 hyp hypothetical protein 580 580 coexpression:580
Rv3527 hyp hypothetical protein 575 575 ctx cooccurence:574
Rv2049c hyp hypothetical protein 549 549 ctx cooccurence:548
Rv0996 transmembrane protein 617 536 ctx cooccurence:535
Rv3851 membrane protein 531 531 ctx neighborhood:526
Rv3004 cfp6 low molecular weight protein antigen 6 524 524 ctx cooccurence:524
Rv2042c hyp hypothetical protein 519 519 ctx cooccurence:519

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-1 transcriptional regulator EspR
  • MTBC0 PGAP product: type VII secretion system ESX-1 transcriptional regulator EspR
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218366.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1476
  • Curated reference: UniProt P9WJB7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 69 functional partner(s); context anchor Rv0882
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004082|Rv3849|espR
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVRRIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA