hemZ Resolved · high auto-curated
H37Rv Rv1485 · MTBC0 mtbc0_001588 ·
344 aa ·
1684822–1685856 MTBC0
(+) ·
RefSeq NP_216001.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ferrochelatase |
|---|---|
| MTBC0 PGAP re-annotation | ferrochelatase |
| Revised (this work) | Ferrochelatase. Pfam: Ferrochelatase (PF00762.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Systematic Evaluation of Mycobacterium tuberculosis Proteins for Antigenic Properties Identifies Rv1485 and Rv1705c as Potential Protective Subunit Vaccine Candidates. doi:10.1128/IAI.00585-20 | 2021 |
| HemZ is essential for heme biosynthesis in Mycobacterium tuberculosis. doi:10.1016/j.tube.2005.01.002 | 2005 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 3 % of gene
| Neighbour | Rv1486c (Rv1486c, - strand) |
|---|---|
| Overlap | 35 bp, 3 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -3.43 (95% CI -3.71 to -3.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in protoheme biosynthesis (last step). Catalyzes the insertion of ferrous iron into protoporphyrin IX to form protoheme [catalytic activity: protoporphyrin + FE(2+) = protoheme + 2 H(+)]. |
|---|---|
| Mycobrowser EC |
4.99.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1521
· 100.0% identity |
|---|---|
| M. leprae |
ML1805c
· 76.8% identity |
| M. marinum |
MMAR_2291
· 82.8% identity |
| M. smegmatis |
MSMEG_3152
· 72.6% identity |
| M. orygis |
RJtmp_001568
· 100.0% identity |
| M. abscessus |
MAB_2721c
· 66.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WNE3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Coproporphyrin III ferrochelatase |
| EC (curated) |
EC 4.99.1.9
|
| Curated function | Involved in coproporphyrin-dependent heme b biosynthesis. Catalyzes the insertion of ferrous iron into coproporphyrin III to form Fe-coproporphyrin III. Has weaker activity with coproporphyrin I, protoporphyrin IX, deuteroporphyrin, 2,4 hydroxyethyl and 2,4 disulfonate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | hemH |
| eggNOG description | Catalyzes the ferrous insertion into protoporphyrin IX |
| Orthologous group | COG0276 |
| EC number |
EC 4.99.1.1, EC 4.99.1.9
|
| KEGG orthology |
K01772
|
| KEGG pathways |
map00860, map01100, map01110
|
| KEGG modules |
M00121
|
| Gene Ontology (45) |
GO:0003674, GO:0003824, GO:0004325, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006725, GO:0006778, GO:0006779, GO:0006783, GO:0006807 +33 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.087 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 80.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 52.2% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 25 in the ORF — 24 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.040, mean read count 1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | hemZ-TetOn 10.1 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 0.332 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - slow growth (less than 1 doubling in a screening wave)) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 13 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 35.7 ppm · rank 1981/3519 (43.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 344 aa |
|---|---|
| Molecular weight | 37.1 kDa |
| Theoretical pI | 5.69 |
| GRAVY | -0.107 (hydrophilic) |
| Aliphatic index | 84.6 |
| Aromaticity | 0.084 |
| Instability index | 42.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ferrochelatase | PF00762.25 | 1.7e-83 | 4–296 | Ferrochelatase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
9f0g-assembly1_A |
1.00 | 0.87 | 3.5e-24 sig | 9f0g-assembly1_A LmCpfC H182A variant in complex with iron coproporhyrin III |
8aw7-assembly1_A |
1.00 | 0.86 | 2.0e-24 sig | 8aw7-assembly1_A Structure of coproporphyrin III-LmCpfC R45L |
8ofl-assembly1_A |
1.00 | 0.87 | 1.9e-23 sig | 8ofl-assembly1_A Coproporphyrin III - LmCpfC complex soaked 4min with Fe2+ |
2h1v-assembly1_A |
1.00 | 0.85 | 3.7e-24 sig | 2h1v-assembly1_A Crystal structure of the Lys87Ala mutant variant of Bacillus subtilis ferrochelatase |
1ak1-assembly1_A |
1.00 | 0.83 | 3.3e-24 sig | 1ak1-assembly1_A FERROCHELATASE FROM BACILLUS SUBTILIS |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | inhA (+ strand, 5 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1486c (- strand, -35 bp gap) |
| Predicted operon |
fabG1 · inhA · hemZ
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1353c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hemY (protoporphyrinogen oxidase), high confidence from genomic context alone (score 993 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2677c hemY exp |
protoporphyrinogen oxidase | 997 | 993 ctx | cooccurence:749 coexpression:712 database:900 textmining:582 |
Rv2676c hemQ hyp |
hypothetical protein | 964 | 958 ctx | fusion:881 coexpression:458 |
Rv2678c hemE |
uroporphyrinogen decarboxylase | 989 | 952 ctx | cooccurence:764 coexpression:773 textmining:788 |
Rv0958 exp |
magnesium chelatase | 926 | 917 | database:900 |
Rv0846c mmcO exp |
oxidase | 925 | 914 | database:900 |
Rv2850c exp |
magnesium chelatase | 942 | 911 | database:900 |
Rv1451 ctaB exp |
protoheme IX farnesyltransferase | 927 | 906 | database:900 |
Rv3841 bfrB exp |
bacterioferritin BfrB | 913 | 901 | database:900 |
Rv1876 bfrA exp |
bacterioferritin BfrA | 936 | 900 | database:900 |
Rv1484 inhA |
NADH-dependent enoyl-[ACP | 904 | 888 ctx | neighborhood:882 |
Rv1483 fabG1 |
3-oxoacyl-ACP reductase FabG | 879 | 862 ctx | neighborhood:857 |
Rv0510 hemC |
porphobilinogen deaminase | 891 | 613 | coexpression:408 textmining:731 |
Rv1480 hyp |
hypothetical protein | 550 | 551 ctx | neighborhood:544 |
Rv1481 |
membrane protein | 591 | 550 ctx | neighborhood:544 |
Rv1479 moxR1 |
transcriptional regulator MoxR1 | 726 | 547 ctx | neighborhood:544 textmining:422 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ferrochelatase
- MTBC0 PGAP product: ferrochelatase
- Pfam (hmmscan --cut_ga): Ferrochelatase PF00762.25 (E=2e-83)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216001.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ferrochelatase (PF00762.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0276 - Curated reference: UniProt P9WNE3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
48 functional partner(s); context anchor
hemY - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001588|Rv1485|hemZ MQFDAVLLLSFGGPEGPEQVRPFLENVTRGRGVPAERLDAVAEHYLHFGGVSPINGINRTLIAELEAQQELPVYFGNRNWEPYVEDAVTAMRDNGVRRAAVFATSAWSGYSSCTQYVEDIARARRAAGRDAPELVKLRPYFDHPLFVEMFADAITAAAATVRGDARLVFTAHSIPTAADRRCGPNLYSRQVAYATRLVAAAAGYCDFDLAWQSRSGPPQVPWLEPDVTDQLTGLAGAGINAVIVCPIGFVADHIEVVWDLDHELRLQAEAAGIAYARASTPNADPRFARLARGLIDELRYGRIPARVSGPDPVPGCLSSINGQPCRPPHCVASVSPARPSAGSP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hemZ? Email the maintainer — the message is pre-filled with this gene's details.