hemZ Resolved · high auto-curated

H37Rv Rv1485 · MTBC0 mtbc0_001588 · 344 aa · 1684822–1685856 (+) · RefSeq NP_216001.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ferrochelatase
MTBC0 PGAP re-annotationferrochelatase
Revised (this work)Ferrochelatase. Pfam: Ferrochelatase (PF00762.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNE3 SwissProt · reviewed · Evidence at protein level
UniProt nameCoproporphyrin III ferrochelatase
EC (curated) EC 4.99.1.9
Curated functionInvolved in coproporphyrin-dependent heme b biosynthesis. Catalyzes the insertion of ferrous iron into coproporphyrin III to form Fe-coproporphyrin III. Has weaker activity with coproporphyrin I, protoporphyrin IX, deuteroporphyrin, 2,4 hydroxyethyl and 2,4 disulfonate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namehemH
eggNOG descriptionCatalyzes the ferrous insertion into protoporphyrin IX
Orthologous groupCOG0276
EC number EC 4.99.1.1, EC 4.99.1.9
KEGG orthology K01772
KEGG pathways map00860, map01100, map01110
KEGG modules M00121
Gene Ontology (45) GO:0003674, GO:0003824, GO:0004325, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006725, GO:0006778, GO:0006779, GO:0006783, GO:0006807 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.087 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FerrochelatasePF00762.25 1.7e-834–296 Ferrochelatase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hemY (protoporphyrinogen oxidase), high confidence from genomic context alone (score 993 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2677c hemY protoporphyrinogen oxidase 997 993 ctx cooccurence:749 coexpression:712 database:900 textmining:582
Rv2676c hemQ hyp hypothetical protein 964 958 ctx fusion:881 coexpression:458
Rv2678c hemE uroporphyrinogen decarboxylase 989 952 ctx cooccurence:764 coexpression:773 textmining:788
Rv0958 magnesium chelatase 926 917 database:900
Rv0846c mmcO oxidase 925 914 database:900
Rv2850c magnesium chelatase 942 911 database:900
Rv1451 ctaB protoheme IX farnesyltransferase 927 906 database:900
Rv3841 bfrB bacterioferritin BfrB 913 901 database:900
Rv1876 bfrA bacterioferritin BfrA 936 900 database:900
Rv1484 inhA NADH-dependent enoyl-[ACP 904 888 ctx neighborhood:882
Rv1483 fabG1 3-oxoacyl-ACP reductase FabG 879 862 ctx neighborhood:857
Rv0510 hemC porphobilinogen deaminase 891 613 coexpression:408 textmining:731
Rv1480 hyp hypothetical protein 550 551 ctx neighborhood:544
Rv1481 membrane protein 591 550 ctx neighborhood:544
Rv1479 moxR1 transcriptional regulator MoxR1 726 547 ctx neighborhood:544 textmining:422

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ferrochelatase
  • MTBC0 PGAP product: ferrochelatase
  • Pfam (hmmscan --cut_ga): Ferrochelatase PF00762.25 (E=2e-83)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216001.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ferrochelatase (PF00762.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0276
  • Curated reference: UniProt P9WNE3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 48 functional partner(s); context anchor hemY
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001588|Rv1485|hemZ
MQFDAVLLLSFGGPEGPEQVRPFLENVTRGRGVPAERLDAVAEHYLHFGGVSPINGINRTLIAELEAQQELPVYFGNRNWEPYVEDAVTAMRDNGVRRAAVFATSAWSGYSSCTQYVEDIARARRAAGRDAPELVKLRPYFDHPLFVEMFADAITAAAATVRGDARLVFTAHSIPTAADRRCGPNLYSRQVAYATRLVAAAAGYCDFDLAWQSRSGPPQVPWLEPDVTDQLTGLAGAGINAVIVCPIGFVADHIEVVWDLDHELRLQAEAAGIAYARASTPNADPRFARLARGLIDELRYGRIPARVSGPDPVPGCLSSINGQPCRPPHCVASVSPARPSAGSP