trxA Family assigned · medium auto-curated

H37Rv Rv1470 · MTBC0 mtbc0_001572 · 124 aa · 1668785–1669159 (+) · RefSeq NP_215986.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thioredoxin TrxA
MTBC0 PGAP re-annotationthioredoxin family protein
Revised (this work)Thioredoxin family protein. Pfam: Thioredoxin (PF00085.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53161 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable thioredoxin TrxA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nametrxA
eggNOG descriptionthioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol, to a disulfide, catalyzes dithiol-disulfide exchange reactions
Orthologous groupCOG3118

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ThioredoxinPF00085.27 2.3e-175–92 Thioredoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trxB1 (thioredoxin), high confidence from genomic context alone (score 815 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1471 trxB1 thioredoxin 819 815 ctx neighborhood:803
Rv3913 trxB2 thioredoxin reductase 942 793 experimental:770 textmining:736
Rv1472 echA12 enoyl-CoA hydratase EchA12 868 743 ctx neighborhood:707 textmining:510
Rv1469 ctpD cobalt/nickel-exporting P-type ATPase 848 690 ctx neighborhood:677 textmining:530
Rv1473 macrolide ABC transporter ATP-binding protein 664 664 ctx neighborhood:620
Rv2299c htpG chaperone protein HtpG 563 529
Rv2643 arsC arsenic-transport integral membrane protein ArsC 645 526 experimental:438
Rv0440 groEL2 molecular chaperone GroEL 552 525
Rv3417c groEL1 chaperonin GroEL 550 522
Rv0794c oxidoreductase 526 476
Rv2234 ptpA protein-tyrosine-phosphatase 506 475 experimental:438
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 732 473 experimental:413 textmining:514
Rv2855 mtr mycothione reductase 612 473
Rv3859c gltB glutamate synthase large subunit 532 469 experimental:455
Rv1436 gap glyceraldehyde 3-phosphate dehydrogenase 514 468 experimental:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: thioredoxin TrxA
  • MTBC0 PGAP product: thioredoxin family protein
  • Pfam (hmmscan --cut_ga): Thioredoxin PF00085.27 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215986.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thioredoxin (PF00085.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3118
  • Curated reference: UniProt O53161 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor trxB1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001572|Rv1470|trxA
MTTRDLTAAYFQQTISANSNVLVYFWAPLCAPCDLFTPTYEASSRKHFDVVHGKVNIETEKDLASIAGVKLLPTLMAFKKGKLVFKQAGIANPAIMDNLVQQLRAYTFKSPAGEGIGPGTKTSS