Rv1482c Family assigned · medium auto-curated
H37Rv Rv1482c · MTBC0 mtbc0_001585 ·
280 aa · 1682262–1683104 (-) ·
RefSeq NP_215998.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Contains AbiEi_1 (PF09407.17) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71763
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Cullin, a subunit of E3 ubiquitin ligase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein conserved in bacteria |
| Orthologous group | COG2852 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.331 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AbiEi_1 | PF09407.17 | 4.1e-05 | 90–170 | AbiEi antitoxin C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fabG1 (3-oxoacyl-ACP reductase FabG), medium confidence from genomic context alone (score 589 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1483 fabG1 |
3-oxoacyl-ACP reductase FabG | 841 | 589 ctx | neighborhood:587 textmining:630 |
Rv1484 inhA |
NADH-dependent enoyl-[ACP | 615 | 535 ctx | neighborhood:535 |
Rv1485 hemZ |
ferrochelatase | 535 | 535 ctx | neighborhood:535 |
Rv3859c gltB |
glutamate synthase large subunit | 522 | 522 | coexpression:515 |
Rv2345 |
transmembrane protein | 511 | 512 ctx | cooccurence:511 |
Rv3492c |
Mce associated protein | 481 | 482 ctx | cooccurence:477 |
Rv0767c |
HTH-type transcriptional regulator | 467 | 467 ctx | cooccurence:462 |
Rv0479c |
membrane protein | 448 | 449 ctx | cooccurence:447 |
Rv2100 hyp |
hypothetical protein | 422 | 423 | |
Rv1251c hyp |
hypothetical protein | 419 | 419 | |
Rv3499c mce4A |
Mce family protein Mce4A | 416 | 416 | |
Rv3776 hyp |
hypothetical protein | 416 | 416 | |
Rv0393 hyp |
hypothetical protein | 402 | 402 | |
Rv3559c |
oxidoreductase | 523 | 47 | textmining:520 |
Rv0769 |
oxidoreductase | 651 | 41 | textmining:651 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Pfam (hmmscan --cut_ga): AbiEi_1 PF09407.17 (E=4e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215998.2)
- Domains: Pfam-A via hmmscan --cut_ga — AbiEi_1 (PF09407.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2852 - Curated reference: UniProt P71763 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
fabG1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001585|Rv1482c| MTDPFLGSEALAAGVLTPYELRSRYVALHKDVYVPQGVELTAQLRAKALWLRSRRRGVLAGYSASAFHGAKWIDADLPAAIIDTNRRRAPGLQVWEERIEPDEICVIEGMRVTTPERTALDLTSRFPLDPAVAAVDALIQATDLKVADVEPLIERYRGRRGMKAARAALDLVDGGAQSPKETWLRLLLIRAGFPRPQTQIAVRNEWGWAEAHLDMGWQDIKVAAEYDGDHHLTSRYHYRKDILRHEKVQHRYGWIVVRVVAEDHPADIIRRVGEARAFRA