Rv1482c Family assigned · medium auto-curated

H37Rv Rv1482c · MTBC0 mtbc0_001585 · 280 aa · 1682262–1683104 (-) · RefSeq NP_215998.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains AbiEi_1 (PF09407.17) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71763 TrEMBL · unreviewed · Predicted
UniProt nameCullin, a subunit of E3 ubiquitin ligase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein conserved in bacteria
Orthologous groupCOG2852

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.331 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AbiEi_1PF09407.17 4.1e-0590–170 AbiEi antitoxin C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fabG1 (3-oxoacyl-ACP reductase FabG), medium confidence from genomic context alone (score 589 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1483 fabG1 3-oxoacyl-ACP reductase FabG 841 589 ctx neighborhood:587 textmining:630
Rv1484 inhA NADH-dependent enoyl-[ACP 615 535 ctx neighborhood:535
Rv1485 hemZ ferrochelatase 535 535 ctx neighborhood:535
Rv3859c gltB glutamate synthase large subunit 522 522 coexpression:515
Rv2345 transmembrane protein 511 512 ctx cooccurence:511
Rv3492c Mce associated protein 481 482 ctx cooccurence:477
Rv0767c HTH-type transcriptional regulator 467 467 ctx cooccurence:462
Rv0479c membrane protein 448 449 ctx cooccurence:447
Rv2100 hyp hypothetical protein 422 423
Rv1251c hyp hypothetical protein 419 419
Rv3499c mce4A Mce family protein Mce4A 416 416
Rv3776 hyp hypothetical protein 416 416
Rv0393 hyp hypothetical protein 402 402
Rv3559c oxidoreductase 523 47 textmining:520
Rv0769 oxidoreductase 651 41 textmining:651

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): AbiEi_1 PF09407.17 (E=4e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215998.2)
  • Domains: Pfam-A via hmmscan --cut_ga — AbiEi_1 (PF09407.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2852
  • Curated reference: UniProt P71763 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor fabG1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001585|Rv1482c|
MTDPFLGSEALAAGVLTPYELRSRYVALHKDVYVPQGVELTAQLRAKALWLRSRRRGVLAGYSASAFHGAKWIDADLPAAIIDTNRRRAPGLQVWEERIEPDEICVIEGMRVTTPERTALDLTSRFPLDPAVAAVDALIQATDLKVADVEPLIERYRGRRGMKAARAALDLVDGGAQSPKETWLRLLLIRAGFPRPQTQIAVRNEWGWAEAHLDMGWQDIKVAAEYDGDHHLTSRYHYRKDILRHEKVQHRYGWIVVRVVAEDHPADIIRRVGEARAFRA