fabG1 Resolved · high auto-curated
H37Rv Rv1483 · MTBC0 mtbc0_001586 ·
247 aa · 1683245–1683988 (+) ·
RefSeq NP_215999.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 3-oxoacyl-ACP reductase FabG |
|---|---|
| MTBC0 PGAP re-annotation | 3-oxoacyl-ACP reductase FabG1 |
| Revised (this work) | 3-oxoacyl-ACP reductase FabG1. Pfam: adh_short (PF00106.32), Epimerase (PF01370.28), adh_short_C2 (PF13561.13), KR (PF08659.17). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGT3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 3-oxoacyl-[acyl-carrier-protein] reductase MabA |
| EC (curated) |
EC 1.1.1.100, EC 1.1.1.36
|
| Curated function | Part of the mycobacterial fatty acid elongation system FAS-II, which is involved in mycolic acid biosynthesis. Catalyzes the NADPH-dependent reduction of beta-ketoacyl derivatives, the second step of the FAS-II elongation cycle. May preferentially metabolize long-chain substrates (C8-C20). Can use CoA derivatives as substrates in vitro. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolismQ Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | fabG1 |
| eggNOG description | reductase |
| Orthologous group | COG1028 |
| EC number |
EC 1.1.1.100
|
| KEGG orthology |
K00059, K11610
|
| KEGG pathways |
map00061, map00333, map00780, map01040, map01100, map01130, map01212
|
| KEGG modules |
M00083, M00572
|
| Gene Ontology (70) |
GO:0000166, GO:0003674, GO:0003824, GO:0004312, GO:0004316, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631 +58 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.07 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
adh_short | PF00106.32 | 4.3e-49 | 17–196 | short chain dehydrogenase |
Epimerase | PF01370.28 | 6.7e-09 | 18–142 | NAD dependent epimerase/dehydratase family |
adh_short_C2 | PF13561.13 | 7.4e-56 | 24–243 | Enoyl-(Acyl carrier protein) reductase |
KR | PF08659.17 | 8.7e-16 | 58–169 | KR domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: inhA (NADH-dependent enoyl-[ACP), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1484 inhA |
NADH-dependent enoyl-[ACP | 997 | 976 ctx | neighborhood:857 coexpression:785 textmining:883 |
Rv1485 hemZ |
ferrochelatase | 879 | 862 ctx | neighborhood:857 |
Rv2243 fabD |
malonyl CoA-acyl carrier protein transacylase | 901 | 841 ctx | cooccurence:716 textmining:407 |
Rv0951 sucC |
succinyl-CoA ligase subunit beta | 833 | 826 | coexpression:805 |
Rv2524c fas |
fatty acid synthase | 857 | 802 | coexpression:509 experimental:475 |
Rv2246 kasB |
3-oxoacyl-ACP synthase 2 | 913 | 794 ctx | cooccurence:658 textmining:598 |
Rv2245 kasA |
3-oxoacyl-ACP synthase 1 | 947 | 792 ctx | cooccurence:655 textmining:759 |
Rv0533c fabH |
3-oxoacyl-ACP synthase III | 872 | 637 ctx | cooccurence:570 textmining:665 |
Rv0635 hadA |
(3R)-hydroxyacyl-ACP dehydratase subunit HadA | 648 | 590 | |
Rv1482c hyp |
hypothetical protein | 841 | 589 ctx | neighborhood:587 textmining:630 |
Rv1479 moxR1 |
transcriptional regulator MoxR1 | 557 | 557 ctx | neighborhood:544 |
Rv1480 hyp |
hypothetical protein | 550 | 551 ctx | neighborhood:544 |
Rv1481 |
membrane protein | 548 | 548 ctx | neighborhood:544 |
Rv1937 |
oxygenase | 593 | 546 | |
Rv0547c |
oxidoreductase | 561 | 545 ctx | cooccurence:478 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 3-oxoacyl-ACP reductase FabG
- MTBC0 PGAP product: 3-oxoacyl-ACP reductase FabG1
- Pfam (hmmscan --cut_ga): adh_short PF00106.32 (E=4e-49), Epimerase PF01370.28 (E=7e-09), adh_short_C2 PF13561.13 (E=7e-56), KR PF08659.17 (E=9e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215999.1)
- Domains: Pfam-A via hmmscan --cut_ga — adh_short (PF00106.32), Epimerase (PF01370.28), adh_short_C2 (PF13561.13), KR (PF08659.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1028 - Curated reference: UniProt P9WGT3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
135 functional partner(s); context anchor
inhA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001586|Rv1483|fabG1 MTATATEGAKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMGH