fabG1 Resolved · high auto-curated

H37Rv Rv1483 · MTBC0 mtbc0_001586 · 247 aa · 1683245–1683988 (+) · RefSeq NP_215999.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3-oxoacyl-ACP reductase FabG
MTBC0 PGAP re-annotation3-oxoacyl-ACP reductase FabG1
Revised (this work)3-oxoacyl-ACP reductase FabG1. Pfam: adh_short (PF00106.32), Epimerase (PF01370.28), adh_short_C2 (PF13561.13), KR (PF08659.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGT3 SwissProt · reviewed · Evidence at protein level
UniProt name3-oxoacyl-[acyl-carrier-protein] reductase MabA
EC (curated) EC 1.1.1.100, EC 1.1.1.36
Curated functionPart of the mycobacterial fatty acid elongation system FAS-II, which is involved in mycolic acid biosynthesis. Catalyzes the NADPH-dependent reduction of beta-ketoacyl derivatives, the second step of the FAS-II elongation cycle. May preferentially metabolize long-chain substrates (C8-C20). Can use CoA derivatives as substrates in vitro.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namefabG1
eggNOG descriptionreductase
Orthologous groupCOG1028
EC number EC 1.1.1.100
KEGG orthology K00059, K11610
KEGG pathways map00061, map00333, map00780, map01040, map01100, map01130, map01212
KEGG modules M00083, M00572
Gene Ontology (70) GO:0000166, GO:0003674, GO:0003824, GO:0004312, GO:0004316, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631 +58 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.07 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
adh_shortPF00106.32 4.3e-4917–196 short chain dehydrogenase
EpimerasePF01370.28 6.7e-0918–142 NAD dependent epimerase/dehydratase family
adh_short_C2PF13561.13 7.4e-5624–243 Enoyl-(Acyl carrier protein) reductase
KRPF08659.17 8.7e-1658–169 KR domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: inhA (NADH-dependent enoyl-[ACP), high confidence from genomic context alone (score 976 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1484 inhA NADH-dependent enoyl-[ACP 997 976 ctx neighborhood:857 coexpression:785 textmining:883
Rv1485 hemZ ferrochelatase 879 862 ctx neighborhood:857
Rv2243 fabD malonyl CoA-acyl carrier protein transacylase 901 841 ctx cooccurence:716 textmining:407
Rv0951 sucC succinyl-CoA ligase subunit beta 833 826 coexpression:805
Rv2524c fas fatty acid synthase 857 802 coexpression:509 experimental:475
Rv2246 kasB 3-oxoacyl-ACP synthase 2 913 794 ctx cooccurence:658 textmining:598
Rv2245 kasA 3-oxoacyl-ACP synthase 1 947 792 ctx cooccurence:655 textmining:759
Rv0533c fabH 3-oxoacyl-ACP synthase III 872 637 ctx cooccurence:570 textmining:665
Rv0635 hadA (3R)-hydroxyacyl-ACP dehydratase subunit HadA 648 590
Rv1482c hyp hypothetical protein 841 589 ctx neighborhood:587 textmining:630
Rv1479 moxR1 transcriptional regulator MoxR1 557 557 ctx neighborhood:544
Rv1480 hyp hypothetical protein 550 551 ctx neighborhood:544
Rv1481 membrane protein 548 548 ctx neighborhood:544
Rv1937 oxygenase 593 546
Rv0547c oxidoreductase 561 545 ctx cooccurence:478

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3-oxoacyl-ACP reductase FabG
  • MTBC0 PGAP product: 3-oxoacyl-ACP reductase FabG1
  • Pfam (hmmscan --cut_ga): adh_short PF00106.32 (E=4e-49), Epimerase PF01370.28 (E=7e-09), adh_short_C2 PF13561.13 (E=7e-56), KR PF08659.17 (E=9e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215999.1)
  • Domains: Pfam-A via hmmscan --cut_ga — adh_short (PF00106.32), Epimerase (PF01370.28), adh_short_C2 (PF13561.13), KR (PF08659.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1028
  • Curated reference: UniProt P9WGT3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 135 functional partner(s); context anchor inhA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001586|Rv1483|fabG1
MTATATEGAKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMGH