Rv1490 Family assigned · medium auto-curated

H37Rv Rv1490 · MTBC0 mtbc0_001594 · 435 aa · 1689127–1690434 (+) · RefSeq NP_216006.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains Rv1490 (PF27463.1) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLX1 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv1490

UniProt still lists this protein as Uncharacterized protein Rv1490; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2A2DJ
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.637 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 13 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (300) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv1490PF27463.1 1.4e-17138–423 Uncharacterised membrane protein Rv1490

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1489A hyp hypothetical protein 508 509 ctx neighborhood:506
Rv1489 hyp hypothetical protein 437 438 ctx neighborhood:434
Rv1488 hyp hypothetical protein 414 414 ctx neighborhood:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv1490 PF27463.1 (E=1e-171)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216006.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv1490 (PF27463.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A2DJ
  • Curated reference: UniProt P9WLX1 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001594|Rv1490|
MSQCFAVKGIGGADQATLGSAEILVKYAQLADKRARVYVLVSTWLVVWGIWHVYFVEAVFPNAILWLHYYAASYEFGFVRRGLGGELIRMLTGDHFFAGAYTVLWTSITVWLIALAVVVWLILSTGNRSERRIMLALLVPVLPFAFSYAIYNPHPELFGMTALVAFSIFLTRAHTSRTRVILSTLYGLTMAVLALIHEAIPLEFALGAVLAIIVLSKNATGATRRICTALAIGPGTVSVLLLAVVGRRDIADQLCAHIPHGMVENPWAVATTPQRVLDYIFGRVESHADYHDWVCEHVTPWFNLDWITSAKLVAVVGFRALFGAFLLGLLFFVATTSMIRYVSAVPVRTFFAELRGNLALPVLASALLVPLFITAVDWTRWWVMITLDVAIVYILYAIDRPEIEQPPSRRNVQVFVCVVLVLAVIPTGSANNIGR