Rv1490 Family assigned · medium auto-curated

H37Rv Rv1490 · MTBC0 mtbc0_001594 · 435 aa · 1689127–1690434 MTBC0 (+) · RefSeq NP_216006.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand ripA (Rv1477) — family_assigned: NlpC/P60 family peptidoglycan endopeptidase RipA ripB (Rv1478) — family_assigned: NlpC/P60 family peptidoglycan endopeptidase RipB Rv1480 (Rv1480) — family_assigned: DUF58 domain-containing protein Rv1480 Rv1481 (Rv1481) — family_assigned: VWA domain-containing protein Rv1481 Rv1482c (Rv1482c) — family_assigned: hypothetical protein Rv1482c fabG1 (Rv1483) — requalified: 3-oxoacyl-ACP reductase FabG1 inhA (Rv1484) — requalified: NADH-dependent enoyl-ACP reductase InhA hemZ (Rv1485) — requalified: ferrochelatase hemZ Rv1486c (Rv1486c) — family_assigned: hypothetical protein Rv1486c Rv1487 (Rv1487) — family_assigned: NfeD family protein Rv1488 (Rv1488) — family_assigned: SPFH domain-containing protein Rv1488 Rv1490 (Rv1490) — family_assigned: hypothetical protein Rv1490 Rv1491c (Rv1491c) — family_assigned: TVP38/TMEM64 family protein mutA (Rv1492) — family_assigned: methylmalonyl-CoA mutase small subunit mutA mutB (Rv1493) — requalified: methylmalonyl-CoA mutase mutB mazE4 (Rv1494) — requalified: type II toxin-antitoxin system antitoxin MazE4 mazF4 (Rv1495) — requalified: type II toxin-antitoxin system toxin endoribonuclease MazF4 meaB (Rv1496) — requalified: methylmalonyl Co-A mutase-associated GTPase MeaB meaB lipL (Rv1497) — family_assigned: serine hydrolase domain-containing protein lipL Rv1499 (Rv1499) — requalified: glycosyltransferase (part1) Rv1500 (Rv1500) — family_assigned: glycosyltransferase family 2 protein Rv1500 Rv1501 (Rv1501) — family_assigned: phytanoyl-CoA dioxygenase family protein 1 680 kb 1 684 kb 1 688 kb 1 692 kb 1 696 kb 1 700 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains Rv1490 (PF27463.1) domain(s); putative function inferred from the domain architecture.
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
Peptides derived from the Mycobacterium tuberculosis Rv1490 surface protein implicated in inhibition of epithelial cell entry: potential vaccine candidates? doi:10.1016/j.vaccine.2008.05.092 2008

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.83 (95% CI -0.65 to 3.26). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1527 · 99.8% identity
M. orygis RJtmp_001574 · 99.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WLX1 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv1490

UniProt still lists this protein as Uncharacterized protein Rv1490; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2A2DJ
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.637 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 13 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (300) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.429 · 10 consensus substitution(s)
under purifying selection vs M. canettii (deep divergence; dN/dS=0.429) — a real, constrained gene predating the MTBC clonal expansion
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 18/53 (34%) · mean identity 42.0% · 1/4 closest MTBAP relatives
present in a subset of the genus (18/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 38 in the ORF — 0 in the essential state, 0 growth-defect, 38 non-essential, 0 growth-advantage. Saturation 0.868, mean read count 43.4848484848. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainRv1490::FLAG-DAS Giles::pTetON-18_sspB (TetON promoter 18)
Baseline knockdown fitness4.368 median doublings (across 5 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionno (Excluded - not in all screening waves)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 2 of 16 independent MS datasets
Integrated abundance0.21 ppm · rank 3431/3519 (2.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (11 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)11

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length435 aa
Molecular weight48.1 kDa
Theoretical pI8.95
GRAVY0.759 (hydrophobic)
Aliphatic index124.4
Aromaticity0.122
Instability index34.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv1490PF27463.1 1.4e-17138–423 Uncharacterised membrane protein Rv1490

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv1489A (+ strand, 149 bp gap)
Downstream (3' on genome)Rv1491c (- strand, 578 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) csoR (activates) · espR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1489A hyp hypothetical protein 508 509 ctx neighborhood:506
Rv1489 hyp hypothetical protein 437 438 ctx neighborhood:434
Rv1488 hyp hypothetical protein 414 414 ctx neighborhood:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv1490 PF27463.1 (E=1e-171)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216006.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv1490 (PF27463.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A2DJ
  • Curated reference: UniProt P9WLX1 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001594|Rv1490|
MSQCFAVKGIGGADQATLGSAEILVKYAQLADKRARVYVLVSTWLVVWGIWHVYFVEAVFPNAILWLHYYAASYEFGFVRRGLGGELIRMLTGDHFFAGAYTVLWTSITVWLIALAVVVWLILSTGNRSERRIMLALLVPVLPFAFSYAIYNPHPELFGMTALVAFSIFLTRAHTSRTRVILSTLYGLTMAVLALIHEAIPLEFALGAVLAIIVLSKNATGATRRICTALAIGPGTVSVLLLAVVGRRDIADQLCAHIPHGMVENPWAVATTPQRVLDYIFGRVESHADYHDWVCEHVTPWFNLDWITSAKLVAVVGFRALFGAFLLGLLFFVATTSMIRYVSAVPVRTFFAELRGNLALPVLASALLVPLFITAVDWTRWWVMITLDVAIVYILYAIDRPEIEQPPSRRNVQVFVCVVLVLAVIPTGSANNIGR