nuoE Family assigned · medium auto-curated

H37Rv Rv3149 · MTBC0 mtbc0_003347 · 252 aa · 3537359–3538117 (+) · RefSeq NP_217665.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)NADH-quinone oxidoreductase subunit E
MTBC0 PGAP re-annotationNADH-quinone oxidoreductase subunit NuoE
Revised (this work)NADH-quinone oxidoreductase subunit NuoE. Pfam: 2Fe-2S_thioredx (PF01257.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIV5 SwissProt · reviewed · Evidence at protein level
UniProt nameNADH-quinone oxidoreductase subunit E
EC (curated) EC 7.1.1.-
Curated functionNDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namenuoE
eggNOG descriptionNADH dehydrogenase
Orthologous groupCOG1905
EC number EC 1.6.5.3
KEGG orthology K00334
KEGG pathways map00190, map01100
KEGG modules M00144
Gene Ontology (37) GO:0003674, GO:0003824, GO:0003954, GO:0005575, GO:0005623, GO:0005886, GO:0006091, GO:0008137, GO:0008150, GO:0008152, GO:0009987, GO:0015980 +25 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.262 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
2Fe-2S_thioredxPF01257.26 3.4e-4745–187 Thioredoxin-like [2Fe-2S] ferredoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nuoB (NADH-quinone oxidoreductase subunit B), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 999 1000 ctx neighborhood:882 coexpression:968 experimental:928 database:800 textmining:564
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 999 1000 ctx neighborhood:704 cooccurence:653 coexpression:968 experimental:928 database:800 textmining:603
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 999 1000 ctx neighborhood:727 coexpression:963 experimental:928 database:620 textmining:590
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 999 1000 ctx neighborhood:881 cooccurence:770 coexpression:976 experimental:997 database:838 textmining:774
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 999 1000 ctx neighborhood:882 cooccurence:523 coexpression:968 experimental:928 database:583 textmining:811
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 999 1000 ctx neighborhood:881 fusion:675 cooccurence:774 coexpression:976 experimental:997 database:838 textmining:851
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 999 1000 ctx neighborhood:882 fusion:620 coexpression:969 experimental:928 database:583 textmining:518
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 999 1000 ctx neighborhood:879 coexpression:937 experimental:928 database:620 textmining:644
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 999 1000 ctx neighborhood:760 coexpression:952 experimental:928 database:818 textmining:658
Rv3154 nuoJ NADH-quinone oxidoreductase subunit J 999 999 ctx neighborhood:764 cooccurence:615 coexpression:932 experimental:911
Rv3156 nuoL NADH-quinone oxidoreductase subunit L 999 999 ctx neighborhood:760 coexpression:935 experimental:911 textmining:511
Rv3158 nuoN NADH-quinone oxidoreductase subunit N 998 998 ctx neighborhood:760 coexpression:663 experimental:928 database:606
Rv3155 nuoK NADH-quinone oxidoreductase subunit K 999 996 ctx neighborhood:764 coexpression:812 experimental:911 textmining:746
Rv0310c hyp hypothetical protein 989 988 coexpression:648 experimental:928 database:561
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 987 984 coexpression:803 experimental:922

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: NADH-quinone oxidoreductase subunit E
  • MTBC0 PGAP product: NADH-quinone oxidoreductase subunit NuoE
  • Pfam (hmmscan --cut_ga): 2Fe-2S_thioredx PF01257.26 (E=3e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217665.1)
  • Domains: Pfam-A via hmmscan --cut_ga — 2Fe-2S_thioredx (PF01257.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1905
  • Curated reference: UniProt P9WIV5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 177 functional partner(s); context anchor nuoB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003347|Rv3149|nuoE
MTQPPGQPVFIRLGPPPDEPNQFVVEGAPRSYPPDVLARLEVDAKEIIGRYPDRRSALLPLLHLVQGEDSYLTPAGLRFCADQLGLTGAEVSAVASFYTMYRRRPTGEYLVGVCTNTLCAVMGGDAIFDRLKEHLGVGHDETTSDGVVTLQHIECNAACDYAPVVMVNWEFFDNQTPESARELVDSLRSDTPKAPTRGAPLCGFRQTSRILAGLPDQRPDEGQGGPGAPTLAGLQVARKNDMQAPPTPGADE