drrA Family assigned · medium auto-curated
H37Rv Rv2936 · MTBC0 mtbc0_003119 ·
331 aa · 3293211–3294206 (+) ·
RefSeq NP_217452.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | daunorubicin ABC transporter ATP-binding protein DrrA |
|---|---|
| MTBC0 PGAP re-annotation | daunorubicin ABC transporter ATP-binding protein DrrA |
| Revised (this work) | Daunorubicin ABC transporter ATP-binding protein DrrA. Pfam: ABC_tran (PF00005.34). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQL9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Doxorubicin resistance ATP-binding protein DrrA |
| EC (curated) |
EC 7.6.2.-
|
| Curated function | Part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Responsible for energy coupling to the transport system. Binds ATP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
V Defense mechanisms
|
|---|---|
| Preferred name | drrA |
| eggNOG description | ABC transporter |
| Orthologous group | COG1131 |
| KEGG orthology |
K01990
|
| KEGG modules |
M00254
|
| Gene Ontology (46) |
GO:0000166, GO:0003674, GO:0005488, GO:0005524, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006810, GO:0006869, GO:0008144, GO:0008150 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.689 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ABC_tran | PF00005.34 | 3.4e-30 | 25–169 | ABC transporter |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: drrB (daunorubicin ABC transporter permease DrrB), high confidence from genomic context alone (score 997 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2937 drrB |
daunorubicin ABC transporter permease DrrB | 999 | 997 ctx | neighborhood:881 cooccurence:728 coexpression:913 textmining:948 |
Rv2938 drrC |
daunorubicin ABC transporter permease DrrC | 999 | 996 ctx | neighborhood:836 cooccurence:764 coexpression:913 textmining:807 |
Rv2935 ppsE |
phthiocerol synthesis polyketide synthase type I PpsE | 993 | 981 ctx | neighborhood:867 coexpression:860 textmining:672 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 985 | 974 ctx | neighborhood:874 coexpression:777 textmining:457 |
Rv2934 ppsD |
phthiocerol synthesis polyketide synthase type I PpsD | 955 | 952 ctx | neighborhood:760 coexpression:810 |
Rv2939 papA5 |
phthiocerol/phthiodiolone dimycocerosyl transferase | 983 | 947 ctx | neighborhood:668 coexpression:848 textmining:697 |
Rv2931 ppsA |
phthiocerol synthesis polyketide synthase type I PpsA | 938 | 832 ctx | neighborhood:786 textmining:648 |
Rv2932 ppsB |
phthiocerol synthesis polyketide synthase type I PpsB | 813 | 797 ctx | neighborhood:786 |
Rv2930 fadD26 |
fatty-acid--CoA ligase FadD26 | 897 | 784 ctx | neighborhood:767 textmining:546 |
Rv3758c proV |
glycine betaine/carnitine/choline/L-proline ABC transporter ATP-binding protein ProV | 678 | 678 ctx | fusion:641 |
Rv0194 |
multidrug ABC transporter ATPase/permease | 673 | 636 | database:536 |
Rv1273c |
drug ABC transporter ATP-binding protein | 648 | 632 | database:536 |
Rv1272c |
drug ABC transporter ATP-binding protein | 648 | 632 | database:536 |
Rv1348 irtA |
iron ABC transporter ATP-binding protein/permease IrtA | 641 | 619 | database:536 |
Rv1349 irtB |
iron ABC transporter ATP-binding protein/permease IrtB | 634 | 618 | database:536 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: daunorubicin ABC transporter ATP-binding protein DrrA
- MTBC0 PGAP product: daunorubicin ABC transporter ATP-binding protein DrrA
- Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=3e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217452.1)
- Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1131 - Curated reference: UniProt P9WQL9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
drrB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003119|Rv2936|drrA MRNDDMAVVVNGVRKTYGKGKIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTRPDAGSAIIAGYDVVSEPAGVRRSIMVTGQQVAVDDALSGEQNLVLFGRLWGLSKSAARKRAAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLDPRSRQAIWDLVASFKKLGIATLLTTQYLEEADALSDRIILIDHGIIIAEGTANELKHRAGDTFCEIVPRDLKDLDAIVAALGSLLPEHHRAMLTPDSDRITMPAPDGIRMLVEAARRIDEARIELADIALRRPSLDDVFLAMTTDPTESLTHLVSGSAR