drrA Family assigned · medium auto-curated
H37Rv Rv2936 · MTBC0 mtbc0_003119 ·
331 aa ·
3293211–3294206 MTBC0
(+) ·
RefSeq NP_217452.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | daunorubicin ABC transporter ATP-binding protein DrrA |
|---|---|
| MTBC0 PGAP re-annotation | daunorubicin ABC transporter ATP-binding protein DrrA |
| Revised (this work) | Daunorubicin ABC transporter ATP-binding protein DrrA. Pfam: ABC_tran (PF00005.34). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 16 publications
16 TB publications mention this gene. 16 publication(s) discuss this gene (16 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Determining the effect of a new truncated CecropinA-Magenin2 (CE-MA) hybrid peptide on the expression of multidrug-resistant (MDR) Mycobacterium tuberculosis efflux genes. doi:10.1007/s00203-025-04314-2 | 2025 |
| The role of ABC transporter DrrABC in the export of PDIM in Mycobacterium tuberculosis. doi:10.1016/j.tcsw.2024.100132 | 2024 |
| Comparison Of drrA And drrB Efflux Pump Genes Expression In Drug-Susceptible And -Resistant Mycobacterium tuberculosis Strains Isolated From Tuberculosis Patients In Iran. doi:10.2147/IDR.S221823 | 2019 |
| Differential Expression of Resistant and Efflux Pump Genes in MDR-TB Isolates. doi:10.2174/1871530319666191009153834 | 2020 |
| Scrutinizing the drug resistance mechanism of multi- and extensively-drug resistant Mycobacterium tuberculosis: mutations versus efflux pumps. doi:10.1186/s13756-019-0516-4 | 2019 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | drrB (Rv2937, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.52 (95% CI -0.14 to 4.33). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Probably involved in active transport of antibiotic and phthiocerol dimycocerosate (dim) across the membrane (export). DRRA, DRRB|Rv2936|MTCY19H9.05 and DRRC|Rv2938|MTCY19H9.06 may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. Responsible for energy coupling to the transport system. |
|---|---|
| Mycobrowser EC |
3.6.3.-
· superseded EC numbering; the atlas uses the current class (7.6.2.-)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2961
· 99.7% identity |
|---|---|
| M. leprae |
ML2352c
· 85.2% identity |
| M. marinum |
MMAR_1771
· 83.1% identity |
| M. smegmatis |
MSMEG_6509
· 42.6% identity |
| M. orygis |
RJtmp_003028
· 99.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQL9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Doxorubicin resistance ATP-binding protein DrrA |
| EC (curated) |
EC 7.6.2.-
|
| Curated function | Part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Responsible for energy coupling to the transport system. Binds ATP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
V Defense mechanisms
|
|---|---|
| Preferred name | drrA |
| eggNOG description | ABC transporter |
| Orthologous group | COG1131 |
| KEGG orthology |
K01990
|
| KEGG modules |
M00254
|
| Gene Ontology (46) |
GO:0000166, GO:0003674, GO:0005488, GO:0005524, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006810, GO:0006869, GO:0008144, GO:0008150 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.689 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 66.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 42.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 19 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 15 growth-advantage. Saturation 0.947, mean read count 286.388888889. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -2.69 | 0.04 | required |
| Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) | -2.55 | 0.0042 | required |
| fitness on cholesterol (vs glycerol) (carbon source) | +2.25 | 0.0074 | disruption advantageous |
| Mutants exhibiting altered fitness in the absence of gene marP (other) | -1.98 | 0.0 | required |
| altered fitness under 6 weeks hypoxia (stress) | +1.30 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | -1.20 | 0.006 | required |
| fitness in mouse infection (in vivo) | -1.12 | 0.028 | required |
| fitness in mouse infection (in vivo) | -1.07 | 0.017 | required |
| fitness in mouse infection (in vivo) | -1.03 | 0.049 | required |
Conditional fitness of transposon-disruption mutants across 9 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 83.7 ppm · rank 1424/3519 (59.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 331 aa |
|---|---|
| Molecular weight | 35.8 kDa |
| Theoretical pI | 6.11 |
| GRAVY | -0.001 (hydrophilic) |
| Aliphatic index | 105.2 |
| Aromaticity | 0.039 |
| Instability index | 34.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ABC_tran | PF00005.34 | 3.4e-30 | 25–169 | ABC transporter |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 88.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4yer-assembly1_A |
1.00 | 0.83 | 2.6e-29 sig | 4yer-assembly1_A Crystal structure of an ABC transporter ATP-binding protein (TM_1403) from Thermotoga maritima MSB8 at 2.35 A resolution |
1vpl-assembly1_A-2 |
1.00 | 0.94 | 6.3e-23 sig | 1vpl-assembly1_A-2 Crystal structure of ABC transporter ATP-binding protein (TM0544) from Thermotoga maritima at 2.10 A resolution |
4p33-assembly1_A |
1.00 | 0.90 | 2.1e-22 sig | 4p33-assembly1_A Crystal structure of E. coli LptB-E163Q in complex with ATP-sodium |
7lkp-assembly1_A |
1.00 | 0.84 | 8.2e-24 sig | 7lkp-assembly1_A Structure of ATP-free human ABCA4 |
7tbw-assembly1_A |
1.00 | 0.79 | 1.7e-23 sig | 7tbw-assembly1_A The structure of ATP-bound ABCA1 |
Foldseek search of the AlphaFold DB model (mean pLDDT 88.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 10
| Upstream (5' on genome) | ppsE (+ strand, 10 bp gap) |
|---|---|
| Downstream (3' on genome) | drrB (+ strand, -4 bp gap) |
| Predicted operon |
fadD26 · ppsA · ppsB · ppsC · ppsD · ppsE · drrA · drrB · drrC · papA5
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (5 TF) |
whiB5 (activates) · Rv0023 (represses) · Rv0767c (activates) · Rv1049 (activates) · Rv1816 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: drrB (daunorubicin ABC transporter permease DrrB), high confidence from genomic context alone (score 997 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2937 drrB |
daunorubicin ABC transporter permease DrrB | 999 | 997 ctx | neighborhood:881 cooccurence:728 coexpression:913 textmining:948 |
Rv2938 drrC |
daunorubicin ABC transporter permease DrrC | 999 | 996 ctx | neighborhood:836 cooccurence:764 coexpression:913 textmining:807 |
Rv2935 ppsE |
phthiocerol synthesis polyketide synthase type I PpsE | 993 | 981 ctx | neighborhood:867 coexpression:860 textmining:672 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 985 | 974 ctx | neighborhood:874 coexpression:777 textmining:457 |
Rv2934 ppsD |
phthiocerol synthesis polyketide synthase type I PpsD | 955 | 952 ctx | neighborhood:760 coexpression:810 |
Rv2939 papA5 |
phthiocerol/phthiodiolone dimycocerosyl transferase | 983 | 947 ctx | neighborhood:668 coexpression:848 textmining:697 |
Rv2931 ppsA |
phthiocerol synthesis polyketide synthase type I PpsA | 938 | 832 ctx | neighborhood:786 textmining:648 |
Rv2932 ppsB |
phthiocerol synthesis polyketide synthase type I PpsB | 813 | 797 ctx | neighborhood:786 |
Rv2930 fadD26 |
fatty-acid--CoA ligase FadD26 | 897 | 784 ctx | neighborhood:767 textmining:546 |
Rv3758c proV |
glycine betaine/carnitine/choline/L-proline ABC transporter ATP-binding protein ProV | 678 | 678 ctx | fusion:641 |
Rv0194 exp |
multidrug ABC transporter ATPase/permease | 673 | 636 | database:536 |
Rv1273c exp |
drug ABC transporter ATP-binding protein | 648 | 632 | database:536 |
Rv1272c exp |
drug ABC transporter ATP-binding protein | 648 | 632 | database:536 |
Rv1348 irtA exp |
iron ABC transporter ATP-binding protein/permease IrtA | 641 | 619 | database:536 |
Rv1349 irtB exp |
iron ABC transporter ATP-binding protein/permease IrtB | 634 | 618 | database:536 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: daunorubicin ABC transporter ATP-binding protein DrrA
- MTBC0 PGAP product: daunorubicin ABC transporter ATP-binding protein DrrA
- Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=3e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217452.1)
- Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1131 - Curated reference: UniProt P9WQL9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 88.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
drrB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003119|Rv2936|drrA MRNDDMAVVVNGVRKTYGKGKIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTRPDAGSAIIAGYDVVSEPAGVRRSIMVTGQQVAVDDALSGEQNLVLFGRLWGLSKSAARKRAAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLDPRSRQAIWDLVASFKKLGIATLLTTQYLEEADALSDRIILIDHGIIIAEGTANELKHRAGDTFCEIVPRDLKDLDAIVAALGSLLPEHHRAMLTPDSDRITMPAPDGIRMLVEAARRIDEARIELADIALRRPSLDDVFLAMTTDPTESLTHLVSGSAR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for drrA? Email the maintainer — the message is pre-filled with this gene's details.