PE14 Family assigned · medium auto-curated

H37Rv Rv1214c · MTBC0 - · 110 aa · 1357293–1357625 (-) · RefSeq YP_177797.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE family protein PE14
MTBC0 PGAP re-annotation
Revised (this work)PE family protein PE14. Pfam: PE (PF00934.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N6A7 TrEMBL · unreviewed · Predicted
UniProt namePE family protein PE14

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionacetylesterase activity
Orthologous groupCOG0657
EC number EC 3.1.1.3
KEGG orthology K01046
KEGG pathways map00561, map01100
KEGG modules M00098

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.722 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (245) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 3.1e-311–85 PE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: raaS (transcriptional regulator), medium confidence from genomic context alone (score 450 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1215c hyp hypothetical protein 514 496 ctx neighborhood:496
Rv1219c raaS transcriptional regulator 450 450 ctx neighborhood:444
Rv1216c integral membrane protein 447 447 ctx neighborhood:447
Rv1218c tetronasin ABC transporter ATP-binding protein 444 444 ctx neighborhood:444
Rv1217c tetronasin ABC transporter integral membrane protein 444 444 ctx neighborhood:444

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE14
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=3e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177797.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt L7N6A7 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor raaS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1214c|PE14
MLASAATDLAGIGSALSAANAAAAAPTTAMLAACADEVSAVVASLFARHAQAYQALSLQATAFHQQFVQALTGAGGAYAAAEAVNAAVAQSVQQDVLNVINAPTQALFDR