Rv1205 Family assigned · medium auto-curated
H37Rv Rv1205 · MTBC0 mtbc0_001293 ·
187 aa · 1357161–1357724 (+) ·
RefSeq NP_215721.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | TIGR00730 family Rossman fold protein |
| Revised (this work) | TIGR00730 family Rossman fold protein. Pfam: LDcluster4 (PF18306.7), Lysine_decarbox (PF03641.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05306
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Cytokinin riboside 5'-monophosphate phosphoribohydrolase |
| EC (curated) |
EC 3.2.2.n1
|
| Curated function | Catalyzes the hydrolytic removal of ribose 5'-monophosphate from nitrogen N6-modified adenosines, the final step of bioactive cytokinin synthesis. Is involved in the synthesis of isopentenyladenine (iP) and 2-methylthio-iP (2MeS-iP), the most abundant cytokinins detected in M.tuberculosis lysates and supernatants. Is also able to convert trans-zeatin-riboside monophosphate (tZRMP) to trans-zeatin (tZ) in vitro; however, it may not be involved in the biosynthesis of this minor cytokinin in vivo. Accumulation of Rv1205 sensitizes M.tuberculosis to nitric oxide since cytokinin breakdown products . |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Cytokinin riboside 5'-monophosphate phosphoribohydrolase |
| Orthologous group | COG1611 |
| EC number |
EC 3.2.2.10
|
| KEGG orthology |
K06966
|
| KEGG pathways |
map00230, map00240
|
| Gene Ontology (25) |
GO:0003674, GO:0003824, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009308, GO:0009690, GO:0009691, GO:0009987, GO:0010817 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.334 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LDcluster4 | PF18306.7 | 2.5e-19 | 12–129 | SLOG cluster4 family |
Lysine_decarbox | PF03641.20 | 1.2e-43 | 54–183 | Possible lysine decarboxylase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadD6 (fatty-acid--CoA ligase FadD6), high confidence from genomic context alone (score 853 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1206 fadD6 |
fatty-acid--CoA ligase FadD6 | 853 | 853 ctx | neighborhood:811 |
Rv1208 gpgS |
glucosyl-3-phosphoglycerate synthase | 845 | 785 ctx | neighborhood:748 |
Rv1207 folP2 |
dihydropteroate synthase | 750 | 751 ctx | neighborhood:748 |
Rv1210 tagA |
DNA-3-methyladenine glycosylase I TagA | 558 | 559 ctx | neighborhood:559 |
Rv1204c hyp |
hypothetical protein | 549 | 549 ctx | neighborhood:547 |
Rv1203c hyp |
hypothetical protein | 519 | 519 ctx | neighborhood:517 |
Rv1209 hyp |
hypothetical protein | 516 | 516 ctx | neighborhood:516 |
Rv3051c nrdE |
ribonucleoside-diphosphate reductase subunit alpha | 435 | 436 | coexpression:418 |
Rv0570 nrdZ |
vitamin B12-dependent ribonucleoside-diphosphate reductase | 428 | 429 | coexpression:411 |
Rv3048c nrdF2 |
ribonucleoside-diphosphate reductase subunit beta NrdF2 | 425 | 425 | coexpression:415 |
Rv1981c nrdF1 |
ribonucleoside-diphosphate reductase subunit beta NrdF1 | 423 | 423 | coexpression:413 |
Rv0233 nrdB |
ribonucleoside-diphosphate reductase subunit beta NrdB | 418 | 418 | coexpression:408 |
Rv1094 desA2 |
acyl-ACP desaturase DesA | 412 | 412 | coexpression:406 |
Rv0824c desA1 |
acyl-ACP desaturase DesA | 411 | 412 | coexpression:406 |
Rv1211 hyp |
hypothetical protein | 409 | 409 ctx | neighborhood:407 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: TIGR00730 family Rossman fold protein
- Pfam (hmmscan --cut_ga): LDcluster4 PF18306.7 (E=3e-19), Lysine_decarbox PF03641.20 (E=1e-43)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215721.1)
- Domains: Pfam-A via hmmscan --cut_ga — LDcluster4 (PF18306.7), Lysine_decarbox (PF03641.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1611 - Curated reference: UniProt O05306 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
fadD6 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001293|Rv1205| MSAKIDITGDWTVAVYCAASPTHAELLELAAEVGAAIAGRGWTLVWGGGHVSAMGAVASAARACGGWTVGVIPKMLVYRELADHDADELIVTDTMWERKQIMEDRSDAFIVLPGGVGTLDELFDAWTDGYLGTHDKPIVMVDPWGHFDGLRAWLNGLLDTGYVSPTAMERLVVVDNVKDALRACAPS