Rv1205 Family assigned · medium auto-curated

H37Rv Rv1205 · MTBC0 mtbc0_001293 · 187 aa · 1357161–1357724 (+) · RefSeq NP_215721.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTIGR00730 family Rossman fold protein
Revised (this work)TIGR00730 family Rossman fold protein. Pfam: LDcluster4 (PF18306.7), Lysine_decarbox (PF03641.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05306 SwissProt · reviewed · Evidence at protein level
UniProt nameCytokinin riboside 5'-monophosphate phosphoribohydrolase
EC (curated) EC 3.2.2.n1
Curated functionCatalyzes the hydrolytic removal of ribose 5'-monophosphate from nitrogen N6-modified adenosines, the final step of bioactive cytokinin synthesis. Is involved in the synthesis of isopentenyladenine (iP) and 2-methylthio-iP (2MeS-iP), the most abundant cytokinins detected in M.tuberculosis lysates and supernatants. Is also able to convert trans-zeatin-riboside monophosphate (tZRMP) to trans-zeatin (tZ) in vitro; however, it may not be involved in the biosynthesis of this minor cytokinin in vivo. Accumulation of Rv1205 sensitizes M.tuberculosis to nitric oxide since cytokinin breakdown products .

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionCytokinin riboside 5'-monophosphate phosphoribohydrolase
Orthologous groupCOG1611
EC number EC 3.2.2.10
KEGG orthology K06966
KEGG pathways map00230, map00240
Gene Ontology (25) GO:0003674, GO:0003824, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009308, GO:0009690, GO:0009691, GO:0009987, GO:0010817 +13 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.334 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LDcluster4PF18306.7 2.5e-1912–129 SLOG cluster4 family
Lysine_decarboxPF03641.20 1.2e-4354–183 Possible lysine decarboxylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD6 (fatty-acid--CoA ligase FadD6), high confidence from genomic context alone (score 853 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1206 fadD6 fatty-acid--CoA ligase FadD6 853 853 ctx neighborhood:811
Rv1208 gpgS glucosyl-3-phosphoglycerate synthase 845 785 ctx neighborhood:748
Rv1207 folP2 dihydropteroate synthase 750 751 ctx neighborhood:748
Rv1210 tagA DNA-3-methyladenine glycosylase I TagA 558 559 ctx neighborhood:559
Rv1204c hyp hypothetical protein 549 549 ctx neighborhood:547
Rv1203c hyp hypothetical protein 519 519 ctx neighborhood:517
Rv1209 hyp hypothetical protein 516 516 ctx neighborhood:516
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 435 436 coexpression:418
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 428 429 coexpression:411
Rv3048c nrdF2 ribonucleoside-diphosphate reductase subunit beta NrdF2 425 425 coexpression:415
Rv1981c nrdF1 ribonucleoside-diphosphate reductase subunit beta NrdF1 423 423 coexpression:413
Rv0233 nrdB ribonucleoside-diphosphate reductase subunit beta NrdB 418 418 coexpression:408
Rv1094 desA2 acyl-ACP desaturase DesA 412 412 coexpression:406
Rv0824c desA1 acyl-ACP desaturase DesA 411 412 coexpression:406
Rv1211 hyp hypothetical protein 409 409 ctx neighborhood:407

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: TIGR00730 family Rossman fold protein
  • Pfam (hmmscan --cut_ga): LDcluster4 PF18306.7 (E=3e-19), Lysine_decarbox PF03641.20 (E=1e-43)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215721.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LDcluster4 (PF18306.7), Lysine_decarbox (PF03641.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1611
  • Curated reference: UniProt O05306 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor fadD6
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001293|Rv1205|
MSAKIDITGDWTVAVYCAASPTHAELLELAAEVGAAIAGRGWTLVWGGGHVSAMGAVASAARACGGWTVGVIPKMLVYRELADHDADELIVTDTMWERKQIMEDRSDAFIVLPGGVGTLDELFDAWTDGYLGTHDKPIVMVDPWGHFDGLRAWLNGLLDTGYVSPTAMERLVVVDNVKDALRACAPS