mmpS5 Resolved · high auto-curated
H37Rv Rv0677c · MTBC0 mtbc0_000716 ·
142 aa · 782563–782991 (-) ·
RefSeq NP_215191.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein MmpS5 |
|---|---|
| MTBC0 PGAP re-annotation | siderophore transporter accessory protein MmpS5 |
| Revised (this work) | Siderophore transporter accessory protein MmpS5. Pfam: Mycobact_memb (PF05423.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJS7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Siderophore export accessory protein MmpS5 |
| Curated function | Part of an export system, which is required for biosynthesis and secretion of siderophores. Essential for virulence..; FUNCTION: Overexpression of the system confers non-target based resistance to azoles, clofazimine and bedaquiline, via an efflux mechanism. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | mmpS5 |
| eggNOG description | membrane |
| Orthologous group | 2BG05 |
| Gene Ontology (2) |
GO:0005575, GO:0005576
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Mycobact_memb | PF05423.19 | 2.4e-64 | 5–142 | Mycobacterium membrane protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mmpL5 (transmembrane transport protein MmpL5), high confidence from genomic context alone (score 968 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0676c mmpL5 |
transmembrane transport protein MmpL5 | 998 | 968 ctx | neighborhood:801 coexpression:848 textmining:951 |
Rv0678 mmpR5 hyp |
hypothetical protein | 974 | 814 ctx | neighborhood:601 coexpression:553 textmining:870 |
Rv1219c raaS |
transcriptional regulator | 810 | 731 | coexpression:731 |
Rv1217c |
tetronasin ABC transporter integral membrane protein | 523 | 270 | |
Rv0450c mmpL4 |
transmembrane transport protein MmpL4 | 879 | 74 | textmining:875 |
Rv2339 mmpL9 |
transmembrane transport protein MmpL9 | 432 | 68 | textmining:416 |
Rv1049 |
transcriptional repressor | 699 | 52 | textmining:696 |
Rv0455c hyp |
hypothetical protein | 520 | 50 | textmining:516 |
Rv0880 |
HTH-type transcriptional regulator | 576 | 47 | textmining:574 |
Rv0451c mmpS4 |
membrane protein MmpS4 | 509 | 47 | textmining:506 |
Rv1348 irtA |
iron ABC transporter ATP-binding protein/permease IrtA | 444 | 47 | textmining:441 |
Rv1305 atpE |
ATP synthase subunit C | 828 | 46 | textmining:827 |
Rv0264c hyp |
hypothetical protein | 436 | 46 | textmining:434 |
Rv2983 cofC |
2-phospho-L-lactate guanylyltransferase | 520 | 45 | textmining:518 |
Rv2535c pepQ |
cytoplasmic peptidase PepQ | 642 | 44 | textmining:642 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein MmpS5
- MTBC0 PGAP product: siderophore transporter accessory protein MmpS5
- Pfam (hmmscan --cut_ga): Mycobact_memb PF05423.19 (E=2e-64)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215191.1)
- Domains: Pfam-A via hmmscan --cut_ga — Mycobact_memb (PF05423.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BG05 - Curated reference: UniProt P9WJS7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
18 functional partner(s); context anchor
mmpL5 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000716|Rv0677c|mmpS5 MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFADDPEPFDPKVVEYEVSGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNILAQGDGTSITCRITVDGEVKDERTATGVDALTYCFVKSA