gpgS Resolved · high auto-curated

H37Rv Rv1208 · MTBC0 mtbc0_001296 · 324 aa · 1360586–1361560 (+) · RefSeq NP_215724.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glucosyl-3-phosphoglycerate synthase
MTBC0 PGAP re-annotationglucosyl-3-phosphoglycerate synthase
Revised (this work)Glucosyl-3-phosphoglycerate synthase. Pfam: Glycos_transf_2 (PF00535.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMW9 SwissProt · reviewed · Evidence at protein level
UniProt nameGlucosyl-3-phosphoglycerate synthase
EC (curated) EC 2.4.1.266
Curated functionInvolved in the biosynthesis of 6-O-methylglucose lipopolysaccarides (MGLPs). Catalyzes the transfer of the glucose moiety from UDP-alpha-D-glucose (UDP-Glc) to the position 2 of 3-phospho-D-glycerate (3-PGA) to form glucosyl-3-phosphoglycerate (GPG).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namegpgS
eggNOG descriptionglucosyl-3-phosphoglycerate synthase
Orthologous groupCOG0463
EC number EC 2.4.1.266
KEGG orthology K13693
CAZy family GT81
Gene Ontology (33) GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0006011, GO:0006139, GO:0006725, GO:0006793, GO:0006807, GO:0008150, GO:0008152 +21 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.062 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glycos_transf_2PF00535.33 1.1e-1146–150 Glycosyl transferase family 2

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: folP2 (dihydropteroate synthase), high confidence from genomic context alone (score 889 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1207 folP2 dihydropteroate synthase 915 889 ctx neighborhood:881
Rv1210 tagA DNA-3-methyladenine glycosylase I TagA 826 827 ctx neighborhood:825
Rv1209 hyp hypothetical protein 825 826 ctx neighborhood:825
Rv1206 fadD6 fatty-acid--CoA ligase FadD6 818 818 ctx neighborhood:796
Rv1205 log hyp hypothetical protein 845 785 ctx neighborhood:748
Rv1211 hyp hypothetical protein 552 551 ctx neighborhood:549
Rv2419c gpgP glucosyl-3-phosphoglycerate phosphatase 938 550 database:500 textmining:870
Rv1204c hyp hypothetical protein 430 430
Rv1203c hyp hypothetical protein 401 401 ctx neighborhood:401
Rv3781 rfbE O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE 411 379
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 401 374
Rv1202 dapE succinyl-diaminopimelate desuccinylase DapE 713 323 textmining:595
Rv0236c aftD alpha-(1->3)-arabinofuranosyltransferase 445 298
Rv3032 glycogen synthase 895 197 textmining:875
Rv3030 S-adenosylmethionine-dependent methyltransferase 919 185 textmining:906

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glucosyl-3-phosphoglycerate synthase
  • MTBC0 PGAP product: glucosyl-3-phosphoglycerate synthase
  • Pfam (hmmscan --cut_ga): Glycos_transf_2 PF00535.33 (E=1e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215724.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glycos_transf_2 (PF00535.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0463
  • Curated reference: UniProt P9WMW9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor folP2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001296|Rv1208|gpgS
MTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRPLQVSDVTSGVCATGGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDDSDYTRHTWPVSLVDRPPMKVMRPR