gpgS Resolved · high auto-curated
H37Rv Rv1208 · MTBC0 mtbc0_001296 ·
324 aa ·
1360586–1361560 MTBC0
(+) ·
RefSeq NP_215724.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glucosyl-3-phosphoglycerate synthase |
|---|---|
| MTBC0 PGAP re-annotation | glucosyl-3-phosphoglycerate synthase |
| Revised (this work) | Glucosyl-3-phosphoglycerate synthase. Pfam: Glycos_transf_2 (PF00535.33). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 14 publications
14 TB publications mention this gene. 14 publication(s) discuss this gene (11 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (3), M. abscessus (1), M. leprae (1)).
| Publication | Date |
|---|---|
| A genuine mycobacterial thermophile: Mycobacterium hassiacum growth, survival and GpgS stability at near-pasteurization temperatures. doi:10.1099/mic.0.000898 | 2020 |
| Structural Snapshots and Loop Dynamics along the Catalytic Cycle of Glycosyltransferase GpgS. doi:10.1016/j.str.2017.05.009 | 2017 |
| A Native Ternary Complex Trapped in a Crystal Reveals the Catalytic Mechanism of a Retaining Glycosyltransferase. doi:10.1002/anie.201504617 | 2015 |
| Biochemical characterization of the retaining glycosyltransferase glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis. doi:10.1016/j.abb.2014.10.002 | 2014 |
| Biosynthesis of mycobacterial methylglucose lipopolysaccharides. doi:10.1039/c2np20014g | 2012 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | folP2 (Rv1207, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -4.05 (95% CI -4.38 to -3.75). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Glucosylglycerate biosynthesis [catalytic activity: NDP-glucose + 3-phosphoglycerate = glucosyl-3-phsophoglycerate + NDP] |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1240
· 100.0% identity |
|---|---|
| M. leprae |
ML1064
· 79.8% identity |
| M. marinum |
MMAR_4230
· 82.1% identity |
| M. smegmatis |
MSMEG_5084
· 74.2% identity |
| M. orygis |
RJtmp_001273
· 100.0% identity |
| M. abscessus |
MAB_1346
· 72.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WMW9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Glucosyl-3-phosphoglycerate synthase |
| EC (curated) |
EC 2.4.1.266
|
| Curated function | Involved in the biosynthesis of 6-O-methylglucose lipopolysaccarides (MGLPs). Catalyzes the transfer of the glucose moiety from UDP-alpha-D-glucose (UDP-Glc) to the position 2 of 3-phospho-D-glycerate (3-PGA) to form glucosyl-3-phosphoglycerate (GPG). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | gpgS |
| eggNOG description | glucosyl-3-phosphoglycerate synthase |
| Orthologous group | COG0463 |
| EC number |
EC 2.4.1.266
|
| KEGG orthology |
K13693
|
| CAZy family |
GT81
|
| Gene Ontology (33) |
GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0006011, GO:0006139, GO:0006725, GO:0006793, GO:0006807, GO:0008150, GO:0008152 +21 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.062 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 81.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 59.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 14 in the ORF — 13 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.143, mean read count 1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv1208-gpgS_TetOn10.1 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 4.058 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Mutants exhibiting altered fitness in the absence of gene PE35 (other) | +4.80 | 0.0 | disruption advantageous |
| Mutants exhibiting altered fitness in the absence of gene PPE68 (other) | +4.77 | 0.0 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 24.8 ppm · rank 2195/3519 (37.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 324 aa |
|---|---|
| Molecular weight | 34.4 kDa |
| Theoretical pI | 4.9 |
| GRAVY | 0.131 (hydrophobic) |
| Aliphatic index | 108.0 |
| Aromaticity | 0.046 |
| Instability index | 38.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glycos_transf_2 | PF00535.33 | 1.1e-11 | 46–150 | Glycosyl transferase family 2 |
Experimental structures (Protein Data Bank) 14 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4dec |
X-ray diffraction | 1.98 Å | 100% |
4y6u |
X-ray diffraction | 2.271 Å | 100% |
4y6n |
X-ray diffraction | 2.348 Å | 100% |
3e26 |
X-ray diffraction | 2.5 Å | 100% |
4y7g |
X-ray diffraction | 2.59 Å | 100% |
4ddz |
X-ray diffraction | 2.6 Å | 100% |
5jqq |
X-ray diffraction | 2.6 Å | 100% |
4y9x |
X-ray diffraction | 2.637 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (14 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4dec-assembly1_A-2 |
1.00 | 0.98 | 2.7e-53 sig | 4dec-assembly1_A-2 Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis in complex with Mn2+, uridine-diphosphate (UDP) and phosphoglyceric acid (PGA) |
5jt0-assembly1_A |
1.00 | 0.99 | 9.9e-53 sig | 5jt0-assembly1_A Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis in complex with Mn2+, uridine-diphosphate (UDP) and glucosyl-3-phosphoglycerate (GPG) - GpgS*GPG*UDP*Mn2+ |
5jqx-assembly1_B |
1.00 | 0.99 | 5.8e-53 sig | 5jqx-assembly1_B Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis in complex with phosphoglyceric acid (PGA) - GpgS*PGA |
4de7-assembly1_A-2 |
1.00 | 0.98 | 1.7e-52 sig | 4de7-assembly1_A-2 Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis in complex with Mg2+ and uridine-diphosphate (UDP) |
4y9x-assembly1_A |
1.00 | 0.98 | 2.7e-52 sig | 4y9x-assembly1_A Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis in complex with Mn2+, uridine-diphosphate-glucose (UDP-Glc) and phosphoglyceric acid (PGA) - GpgS Mn2+ UDP-Glc PGA-3 |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | folP2 (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1209 (+ strand, 38 bp gap) |
| Predicted operon |
folP2 · gpgS · Rv1209 · tagA
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1353c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: folP2 (dihydropteroate synthase), high confidence from genomic context alone (score 889 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1207 folP2 |
dihydropteroate synthase | 915 | 889 ctx | neighborhood:881 |
Rv1210 tagA |
DNA-3-methyladenine glycosylase I TagA | 826 | 827 ctx | neighborhood:825 |
Rv1209 hyp |
hypothetical protein | 825 | 826 ctx | neighborhood:825 |
Rv1206 fadD6 |
fatty-acid--CoA ligase FadD6 | 818 | 818 ctx | neighborhood:796 |
Rv1205 log hyp |
hypothetical protein | 845 | 785 ctx | neighborhood:748 |
Rv1211 hyp |
hypothetical protein | 552 | 551 ctx | neighborhood:549 |
Rv2419c gpgP exp |
glucosyl-3-phosphoglycerate phosphatase | 938 | 550 | database:500 textmining:870 |
Rv1204c hyp |
hypothetical protein | 430 | 430 | |
Rv1203c hyp |
hypothetical protein | 401 | 401 ctx | neighborhood:401 |
Rv3781 rfbE |
O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE | 411 | 379 | |
Rv3805c aftB |
terminal beta-(1->2)-arabinofuranosyltransferase | 401 | 374 | |
Rv1202 dapE |
succinyl-diaminopimelate desuccinylase DapE | 713 | 323 | textmining:595 |
Rv0236c aftD |
alpha-(1->3)-arabinofuranosyltransferase | 445 | 298 | |
Rv3032 |
glycogen synthase | 895 | 197 | textmining:875 |
Rv3030 |
S-adenosylmethionine-dependent methyltransferase | 919 | 185 | textmining:906 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glucosyl-3-phosphoglycerate synthase
- MTBC0 PGAP product: glucosyl-3-phosphoglycerate synthase
- Pfam (hmmscan --cut_ga): Glycos_transf_2 PF00535.33 (E=1e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215724.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glycos_transf_2 (PF00535.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0463 - Curated reference: UniProt P9WMW9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
folP2 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001296|Rv1208|gpgS MTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRPLQVSDVTSGVCATGGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDDSDYTRHTWPVSLVDRPPMKVMRPR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for gpgS? Email the maintainer — the message is pre-filled with this gene's details.