Rv1209 Family assigned · low auto-curated
H37Rv Rv1209 · MTBC0 mtbc0_001297 ·
122 aa · 1361599–1361967 (+) ·
RefSeq NP_215725.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DivIVA domain-containing protein |
| Revised (this work) | DivIVA domain-containing protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05310
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| eggNOG description | regulation of cell shape |
| Orthologous group | COG3599 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: tagA (DNA-3-methyladenine glycosylase I TagA), high confidence from genomic context alone (score 887 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3682 ponA2 |
bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase | 930 | 906 | experimental:807 |
Rv1210 tagA |
DNA-3-methyladenine glycosylase I TagA | 887 | 887 ctx | neighborhood:881 |
Rv1207 folP2 |
dihydropteroate synthase | 826 | 827 ctx | neighborhood:825 |
Rv1208 gpgS |
glucosyl-3-phosphoglycerate synthase | 825 | 826 ctx | neighborhood:825 |
Rv3311 hyp |
hypothetical protein | 776 | 770 ctx | cooccurence:770 |
Rv2520c |
membrane protein | 768 | 768 ctx | cooccurence:768 |
Rv3212 hyp |
hypothetical protein | 762 | 762 ctx | cooccurence:760 |
Rv1211 hyp |
hypothetical protein | 757 | 757 ctx | neighborhood:754 |
Rv2446c |
integral membrane protein | 756 | 756 ctx | cooccurence:754 |
Rv1109c hyp |
hypothetical protein | 754 | 755 ctx | cooccurence:753 |
Rv0863 hyp |
hypothetical protein | 753 | 754 ctx | cooccurence:752 |
Rv2980 hyp |
hypothetical protein | 751 | 751 ctx | cooccurence:743 |
Rv2091c |
membrane protein | 757 | 748 ctx | cooccurence:745 |
Rv0556 |
transmembrane protein | 748 | 748 ctx | cooccurence:747 |
Rv1083 hyp |
hypothetical protein | 742 | 742 ctx | cooccurence:740 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DivIVA domain-containing protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215725.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3599 - Curated reference: UniProt O05310 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
105 functional partner(s); context anchor
tagA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001297|Rv1209| MALVLVYLVVLVLVAIVLFAAASLLFGRGEQLPPLPRATTATTLPAFGVTRADVDAVKFTQVLRGYKTSEVDWVLERLGRELEALRSQLGAIHASSEDAEAESDASNPSRGETVVHYRSDPA