mmr Resolved · high auto-curated

H37Rv Rv3065 · MTBC0 - · 107 aa · 3430387–3430710 (+) · RefSeq YP_177922.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)multidrug resistance protein Mmr
MTBC0 PGAP re-annotation
Revised (this work)Multidrug resistance protein Mmr. Pfam: Multi_Drug_Res (PF00893.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WGF1 SwissProt · reviewed · Evidence at protein level
UniProt nameMultidrug resistance protein Mmr
Curated functionMultidrug efflux pump. Confers resistance to tetraphenylphosphonium (TPP), erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y and methyl viologen.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namemmr
eggNOG descriptionMultidrug resistance protein
Orthologous groupCOG2076
KEGG orthology K03297
Gene Ontology (21) GO:0003674, GO:0005215, GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0006810, GO:0008150, GO:0015562, GO:0016020, GO:0016021, GO:0022857 +9 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Multi_Drug_ResPF00893.26 1.1e-291–94 Small Multidrug Resistance protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3066 (DeoR family transcriptional regulator), high confidence from genomic context alone (score 885 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3066 DeoR family transcriptional regulator 959 885 ctx neighborhood:881 textmining:660
Rv3064c integral membrane protein 593 594 ctx neighborhood:577
Rv3067 hyp hypothetical protein 534 534 ctx neighborhood:527
Rv3396c guaA GMP synthase 406 172
Rv1217c tetronasin ABC transporter integral membrane protein 507 170 textmining:431
Rv3728 membrane protein 545 155 textmining:484
Rv0524 hemL glutamate-1-semialdehyde 2,1-aminomutase 532 114 textmining:494
Rv3000 transmembrane protein 444 54 textmining:437
Rv2846c efpA MFS-type transporter EfpA 678 51 textmining:675
Rv2459 jefA MFS-type transporter 813 48 textmining:812
Rv0849 MFS-type transporter 566 48 textmining:563
Rv1995 hyp hypothetical protein 476 47 textmining:473
Rv1258c tap multidrug-efflux transporter 812 45 textmining:812
Rv1819c bacA vitamin B12 transport ATP-binding protein BacA 569 44 textmining:568

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): multidrug resistance protein Mmr
  • Pfam (hmmscan --cut_ga): Multi_Drug_Res PF00893.26 (E=1e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177922.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Multi_Drug_Res (PF00893.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2076
  • Curated reference: UniProt P9WGF1 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv3066
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3065|mmr
MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH