mmr Resolved · high auto-curated
H37Rv Rv3065 · MTBC0 - ·
107 aa ·
3430387–3430710 H37Rv
(+) ·
RefSeq YP_177922.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | multidrug resistance protein Mmr |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Multidrug resistance protein Mmr. Pfam: Multi_Drug_Res (PF00893.26). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 94 publications
94 TB publications mention this gene. 94 publication(s) discuss this gene (174 in a M. tuberculosis context, 14 in other mycobacteria — M. smegmatis (11), M. abscessus (1), M. leprae (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Qualitative Analysis of Maternal Mortality Reporting Gaps and the Emerging Fourth Delay in Garut Regency, Indonesia. doi:10.2147/IJWH.S552705 | 2026 |
| Dendritic cells in the lung cavities of extensively drug-resistant tuberculosis patients exhibit altered frequency and phenotype. doi:10.1183/23120541.00155-2025 | 2026 |
| The unique role of nucS-mediated noncanonical mismatch repair in Mycobacterium tuberculosis resistance evolution. doi:10.1128/mbio.03310-25 | 2026 |
| Regulation of the Expression of nucS, a Key Component of the Mismatch Repair System in Mycobacteria. doi:10.3390/antibiotics14111065 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv3066 (Rv3066, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
MbcA+Rv3249c+Rv3066 (mbcA and Rv3249c and Rv3066).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.50 (95% CI -0.48 to 1.97). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in transport of multidrugs (tetraphenylphosphonium, erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y, etc) across the membrane (export): multidrugs resistance by an export mechanism (conferes resistance to toxic compounds by removing them for the cells). Responsible for the translocation of the substrate across the membrane. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3092
· 100.0% identity |
|---|---|
| M. leprae |
ML1756
· 79.0% identity |
| M. marinum |
MMAR_1612
· 75.2% identity |
| M. orygis |
RJtmp_003168
· 100.0% identity |
| M. abscessus |
MAB_2640c
· 35.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGF1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Multidrug resistance protein Mmr |
| Curated function | Multidrug efflux pump. Confers resistance to tetraphenylphosphonium (TPP), erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y and methyl viologen. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | mmr |
| eggNOG description | Multidrug resistance protein |
| Orthologous group | COG2076 |
| KEGG orthology |
K03297
|
| Gene Ontology (21) |
GO:0003674, GO:0005215, GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0006810, GO:0008150, GO:0015562, GO:0016020, GO:0016021, GO:0022857 +9 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 46/53 (87%) · mean identity 78.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 46/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 43.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 210.555555556. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (4 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 4 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 107 aa |
|---|---|
| Molecular weight | 11.1 kDa |
| Theoretical pI | 6.69 |
| GRAVY | 1.436 (hydrophobic) |
| Aliphatic index | 147.6 |
| Aromaticity | 0.093 |
| Instability index | 9.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Multi_Drug_Res | PF00893.26 | 1.1e-29 | 1–94 | Small Multidrug Resistance protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8uwu-assembly1_A |
1.00 | 0.84 | 2.6e-06 sig | 8uwu-assembly1_A EmrE structure in the proton-bound state (WT/L51I heterodimer) |
7szt-assembly1_B |
1.00 | 0.82 | 1.0e-05 sig | 7szt-assembly1_B Crystal structure of Gdx-Clo from Small Multidrug Resistance family of transporters in low pH (protonated state) |
8vxu-assembly2_D |
1.00 | 0.82 | 1.4e-05 sig | 8vxu-assembly2_D Crystal structure of Gdx-Clo A60T from Small Multidrug Resistance family of transporters in complex with cetyltrimetylammonium |
8tgy-assembly1_A |
1.00 | 0.86 | 1.4e-05 sig | 8tgy-assembly1_A Crystal structure of Gdx-Clo from Small Multidrug Resistance family of transporters in complex with guanylurea |
8uoz-assembly1_A |
1.00 | 0.84 | 2.4e-05 sig | 8uoz-assembly1_A EmrE structure in the TPP-bound state (WT/E14Q heterodimer) |
Foldseek search of the AlphaFold DB model (mean pLDDT 87.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv3064c (- strand, 136 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3066 (+ strand, -4 bp gap) |
| Predicted operon |
mmr · Rv3066
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (4 TF) |
Rv0023 (activates) · Rv0081 (activates) · mmpR5 (activates) · Rv3066 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv3066 (DeoR family transcriptional regulator), high confidence from genomic context alone (score 885 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3066 |
DeoR family transcriptional regulator | 959 | 885 ctx | neighborhood:881 textmining:660 |
Rv3064c |
integral membrane protein | 593 | 594 ctx | neighborhood:577 |
Rv3067 hyp |
hypothetical protein | 534 | 534 ctx | neighborhood:527 |
Rv3396c guaA |
GMP synthase | 406 | 172 | |
Rv1217c |
tetronasin ABC transporter integral membrane protein | 507 | 170 | textmining:431 |
Rv3728 |
membrane protein | 545 | 155 | textmining:484 |
Rv0524 hemL |
glutamate-1-semialdehyde 2,1-aminomutase | 532 | 114 | textmining:494 |
Rv3000 |
transmembrane protein | 444 | 54 | textmining:437 |
Rv2846c efpA |
MFS-type transporter EfpA | 678 | 51 | textmining:675 |
Rv2459 jefA |
MFS-type transporter | 813 | 48 | textmining:812 |
Rv0849 |
MFS-type transporter | 566 | 48 | textmining:563 |
Rv1995 hyp |
hypothetical protein | 476 | 47 | textmining:473 |
Rv1258c tap |
multidrug-efflux transporter | 812 | 45 | textmining:812 |
Rv1819c bacA |
vitamin B12 transport ATP-binding protein BacA | 569 | 44 | textmining:568 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): multidrug resistance protein Mmr
- Pfam (hmmscan --cut_ga): Multi_Drug_Res PF00893.26 (E=1e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177922.1)
- Domains: Pfam-A via hmmscan --cut_ga — Multi_Drug_Res (PF00893.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2076 - Curated reference: UniProt P9WGF1 (SwissProt, reviewed; Evidence at protein level)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
Rv3066 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3065|mmr MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mmr? Email the maintainer — the message is pre-filled with this gene's details.