mmr Resolved · high auto-curated
H37Rv Rv3065 · MTBC0 - ·
107 aa · 3430387–3430710 (+) ·
RefSeq YP_177922.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | multidrug resistance protein Mmr |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Multidrug resistance protein Mmr. Pfam: Multi_Drug_Res (PF00893.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WGF1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Multidrug resistance protein Mmr |
| Curated function | Multidrug efflux pump. Confers resistance to tetraphenylphosphonium (TPP), erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y and methyl viologen. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | mmr |
| eggNOG description | Multidrug resistance protein |
| Orthologous group | COG2076 |
| KEGG orthology |
K03297
|
| Gene Ontology (21) |
GO:0003674, GO:0005215, GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0006810, GO:0008150, GO:0015562, GO:0016020, GO:0016021, GO:0022857 +9 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Multi_Drug_Res | PF00893.26 | 1.1e-29 | 1–94 | Small Multidrug Resistance protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3066 (DeoR family transcriptional regulator), high confidence from genomic context alone (score 885 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3066 |
DeoR family transcriptional regulator | 959 | 885 ctx | neighborhood:881 textmining:660 |
Rv3064c |
integral membrane protein | 593 | 594 ctx | neighborhood:577 |
Rv3067 hyp |
hypothetical protein | 534 | 534 ctx | neighborhood:527 |
Rv3396c guaA |
GMP synthase | 406 | 172 | |
Rv1217c |
tetronasin ABC transporter integral membrane protein | 507 | 170 | textmining:431 |
Rv3728 |
membrane protein | 545 | 155 | textmining:484 |
Rv0524 hemL |
glutamate-1-semialdehyde 2,1-aminomutase | 532 | 114 | textmining:494 |
Rv3000 |
transmembrane protein | 444 | 54 | textmining:437 |
Rv2846c efpA |
MFS-type transporter EfpA | 678 | 51 | textmining:675 |
Rv2459 jefA |
MFS-type transporter | 813 | 48 | textmining:812 |
Rv0849 |
MFS-type transporter | 566 | 48 | textmining:563 |
Rv1995 hyp |
hypothetical protein | 476 | 47 | textmining:473 |
Rv1258c tap |
multidrug-efflux transporter | 812 | 45 | textmining:812 |
Rv1819c bacA |
vitamin B12 transport ATP-binding protein BacA | 569 | 44 | textmining:568 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): multidrug resistance protein Mmr
- Pfam (hmmscan --cut_ga): Multi_Drug_Res PF00893.26 (E=1e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177922.1)
- Domains: Pfam-A via hmmscan --cut_ga — Multi_Drug_Res (PF00893.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2076 - Curated reference: UniProt P9WGF1 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
Rv3066 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3065|mmr MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH