tagA Resolved · high auto-curated

H37Rv Rv1210 · MTBC0 mtbc0_001298 · 204 aa · 1361964–1362578 (+) · RefSeq NP_215726.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)DNA-3-methyladenine glycosylase I TagA
MTBC0 PGAP re-annotationDNA-3-methyladenine glycosylase I
Revised (this work)DNA-3-methyladenine glycosylase I. Pfam: Adenine_glyco (PF03352.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05311 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable DNA-3-methyladenine glycosylase I TagA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred nametag
eggNOG descriptionDNA-3-methyladenine glycosylase I
Orthologous groupCOG2818
EC number EC 3.2.2.20
KEGG orthology K01246
KEGG pathways map03410

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.167 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.38% of strains (555) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Adenine_glycoPF03352.19 7.6e-6720–187 Methyladenine glycosylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: folP2 (dihydropteroate synthase), high confidence from genomic context alone (score 831 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1209 hyp hypothetical protein 887 887 ctx neighborhood:881
Rv1207 folP2 dihydropteroate synthase 830 831 ctx neighborhood:825
Rv1208 gpgS glucosyl-3-phosphoglycerate synthase 826 827 ctx neighborhood:825
Rv1316c ogt methylated-DNA--protein-cysteine methyltransferase 793 785 ctx fusion:667
Rv1211 hyp hypothetical protein 949 756 ctx neighborhood:755 textmining:803
Rv1206 fadD6 fatty-acid--CoA ligase FadD6 756 756 ctx neighborhood:756
Rv1205 log hyp hypothetical protein 558 559 ctx neighborhood:559
Rv1629 polA DNA polymerase I 693 446 textmining:470
Rv0995 rimJ ribosomal-protein-alanine acetyltransferase RimJ 446 446 ctx cooccurence:417
Rv1657 argR arginine repressor 426 427 coexpression:400
Rv1537 dinX DNA polymerase IV 611 241 textmining:509
Rv1317c alkA bifunctional regulatory protein/DNA repair enzyme AlkA 632 236 textmining:539
Rv3056 dinP DNA polymerase IV 2 646 191 textmining:581
Rv3589 mutY A/G-specific adenine glycosylase 741 117 textmining:719
Rv1638 uvrA excinuclease ABC subunit UvrA 410 113

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: DNA-3-methyladenine glycosylase I TagA
  • MTBC0 PGAP product: DNA-3-methyladenine glycosylase I
  • Pfam (hmmscan --cut_ga): Adenine_glyco PF03352.19 (E=8e-67)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215726.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Adenine_glyco (PF03352.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2818
  • Curated reference: UniProt O05311 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor folP2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001298|Rv1210|tagA
MSGDGLVRCPWAEVRPGPDAQLYRDYHDNEWGRPLYGRVALFERMSLEAFQSGLSWLIILRKRENFRRAFSGFDIDKIARYTDTDVRRLLADDGIVRNRAKIEATIANARAAADLGSSEDLSELLWSFAPPPRPRPVDGSEIPSVSTESKAMSRELKRRGFRFVGPTTAYALMQATGMVDDHIQACWVPTERPFDQPGCPMAAR