folP2 Resolved · high auto-curated

H37Rv Rv1207 · MTBC0 mtbc0_001295 · 318 aa · 1359633–1360589 (+) · RefSeq NP_215723.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dihydropteroate synthase
MTBC0 PGAP re-annotationdihydropteroate synthase
Revised (this work)Dihydropteroate synthase. Pfam: Pterin_bind (PF00809.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNC9 SwissProt · reviewed · Evidence at protein level
UniProt nameInactive dihydropteroate synthase 2
Curated functionHas very low affinity for the DHPS substrate 6-hydroxymethyl-7,8-dihydropterin-pyrophosphate, but can bind the inhibitor dapsone. Seems to lack dihydropteroate synthase activity, and does probably not function in folate metabolism.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namefolP2
eggNOG descriptionCatalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the immediate precursor of folate derivatives
Orthologous groupCOG0294
EC number EC 2.5.1.15
KEGG orthology K00796
KEGG pathways map00790, map01100
KEGG modules M00126, M00841
Gene Ontology (8) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.25 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pterin_bindPF00809.29 7.2e-7245–289 Pterin binding enzyme

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: folK (2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase), high confidence from genomic context alone (score 993 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3606c folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase 996 993 ctx cooccurence:753 coexpression:731 database:900 textmining:518
Rv3607c folB dihydroneopterin aldolase 992 986 ctx cooccurence:470 coexpression:735 database:900 textmining:497
Rv2447c folC folylpolyglutamate synthase FolC 993 985 ctx fusion:603 coexpression:431 database:900 textmining:603
Rv3608c folP1 dihydropteroate synthase 939 925 database:900
Rv0812 4-amino-4-deoxychorismate lyase 925 919 database:900
Rv1208 gpgS glucosyl-3-phosphoglycerate synthase 915 889 ctx neighborhood:881
Rv3609c folE GTP cyclohydrolase I 928 876 ctx cooccurence:518 coexpression:733 textmining:445
Rv1210 tagA DNA-3-methyladenine glycosylase I TagA 830 831 ctx neighborhood:825
Rv1209 hyp hypothetical protein 826 827 ctx neighborhood:825
Rv1206 fadD6 fatty-acid--CoA ligase FadD6 798 798 ctx neighborhood:796
Rv1205 log hyp hypothetical protein 750 751 ctx neighborhood:748
Rv0013 trpG anthranilate synthase component II 602 562 coexpression:419
Rv1211 hyp hypothetical protein 551 550 ctx neighborhood:549
Rv1005c pabB para-aminobenzoate synthase component I 551 484
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 517 461 coexpression:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dihydropteroate synthase
  • MTBC0 PGAP product: dihydropteroate synthase
  • Pfam (hmmscan --cut_ga): Pterin_bind PF00809.29 (E=7e-72)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215723.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pterin_bind (PF00809.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0294
  • Curated reference: UniProt P9WNC9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor folK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001295|Rv1207|folP2
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGATFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLISVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRVSYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLVMTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEMVASIQGVRPPTRTVRGLA