esxK Resolved · high auto-curated

H37Rv Rv1197 · MTBC0 mtbc0_001285 · 98 aa · 1349101–1349397 (+) · RefSeq NP_215713.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxK
MTBC0 PGAP re-annotationtype VII secretion system ESX-5 protein EsxJ
Revised (this work)Type VII secretion system ESX-5 protein EsxJ. Pfam: WXG100 (PF06013.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNJ7 SwissProt · reviewed · Evidence at protein level
UniProt nameESAT-6-like protein EsxK

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameesxP
eggNOG descriptionBelongs to the WXG100 family
Orthologous groupCOG4842
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.055 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 6.4e-205–90 Proteins of 100 residues with WXG

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxL (ESAT-6 like protein EsxL), high confidence from genomic context alone (score 945 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1198 esxL ESAT-6 like protein EsxL 993 945 ctx neighborhood:626 coexpression:860 textmining:878
Rv1196 PPE18 PPE family protein PPE18 964 892 ctx neighborhood:488 coexpression:798 textmining:685
Rv2346c esxO ESAT-6 like protein EsxO 964 865 coexpression:860 textmining:746
Rv1793 esxN ESAT-6 like protein EsxN 940 865 coexpression:860 textmining:578
Rv2347c esxP ESAT-6 like protein EsxP 861 860 coexpression:860
Rv1038c esxJ ESAT-6 like protein EsxJ 861 860 coexpression:860
Rv3620c esxW ESAT-6 like protein EsxW 860 860 coexpression:860
Rv3619c esxV ESAT-6 like protein EsxV 918 853 coexpression:848 textmining:470
Rv3648c cspA cold shock protein A 802 803 coexpression:800
Rv3874 esxB ESAT-6-like protein EsxB 898 802 coexpression:802 textmining:508
Rv3875 esxA ESAT-6 protein EsxA 903 800 coexpression:800 textmining:537
Rv1037c esxI ESAT-6 like protein EsxI 922 767 coexpression:759 textmining:680
Rv0685 tuf elongation factor Tu 731 731 coexpression:731
Rv0287 esxG ESAT-6 like protein EsxG 625 465
Rv1872c lldD2 L-lactate dehydrogenase 441 441 coexpression:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6 like protein EsxK
  • MTBC0 PGAP product: type VII secretion system ESX-5 protein EsxJ
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=6e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215713.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4842
  • Curated reference: UniProt P9WNJ7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor esxL
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001285|Rv1197|esxK
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS