esxG Resolved · high auto-curated

H37Rv Rv0287 · MTBC0 mtbc0_000306 · 97 aa · 354819–355112 (+) · RefSeq NP_214801.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxG
MTBC0 PGAP re-annotationtype VII secretion system protein EsxG
Revised (this work)Type VII secretion system protein EsxG. Pfam: WXG100 (PF06013.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53692 SwissProt · reviewed · Evidence at protein level
UniProt nameESAT-6-like protein EsxG
Curated functionEsxG, in complex with EsxH, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery. EsxG stabilizes EsxH in the host cytosol.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred nameesxG
Orthologous group2A0FY
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 1.0e-0610–87 Proteins of 100 residues with WXG

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxH (ESAT-6-like protein EsxH), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0288 esxH ESAT-6-like protein EsxH 999 1000 ctx neighborhood:727 coexpression:860 experimental:993 textmining:993
Rv0289 espG3 ESX-3 secretion-associated protein EspG3 974 940 ctx neighborhood:707 coexpression:802 textmining:595
Rv0290 eccD3 ESX-3 secretion system protein EccD 951 885 ctx neighborhood:592 coexpression:730 textmining:594
Rv3019c esxR ESAT-6 like protein EsxR 956 833 experimental:822 textmining:751
Rv3017c esxQ ESAT-6 like protein EsxQ 915 833 experimental:822 textmining:517
Rv0286 PPE4 PPE family protein PPE4 932 755 ctx neighborhood:644 textmining:736
Rv0291 mycP3 membrane-anchored mycosin MycP 726 687 ctx neighborhood:592
Rv0292 eccE3 ESX-3 secretion system protein EccE 824 685 ctx neighborhood:592 textmining:467
Rv0283 eccB3 ESX-3 secretion system protein EccB3 817 681 ctx neighborhood:663 textmining:454
Rv0284 eccC3 ESX-3 secretion system protein EccC3 797 681 ctx neighborhood:663
Rv0282 eccA3 ESX-3 secretion system protein EccA 770 678 ctx neighborhood:663
Rv0285 PE5 PE family protein PE5 912 663 ctx neighborhood:663 textmining:752
Rv3874 esxB ESAT-6-like protein EsxB 927 549 textmining:846
Rv1038c esxJ ESAT-6 like protein EsxJ 667 512
Rv3875 esxA ESAT-6 protein EsxA 867 468 textmining:761

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6 like protein EsxG
  • MTBC0 PGAP product: type VII secretion system protein EsxG
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=1e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214801.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A0FY
  • Curated reference: UniProt O53692 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor esxH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000306|Rv0287|esxG
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF