esxG Resolved · high auto-curated
H37Rv Rv0287 · MTBC0 mtbc0_000306 ·
97 aa ·
354819–355112 MTBC0
(+) ·
RefSeq NP_214801.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxG |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system protein EsxG |
| Revised (this work) | Type VII secretion system protein EsxG. Pfam: WXG100 (PF06013.19). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 38 publications
38 TB publications mention this gene. 38 publication(s) discuss this gene (35 in a M. tuberculosis context, 10 in other mycobacteria — M. smegmatis (6), M. abscessus (2), M. leprae (2)).
| Publication | Date |
|---|---|
| Meta-analysis reveals a core iron-responsive gene signature in Mycobacterium tuberculosis linking siderophore biosynthesis, virulence, and metabolic adaptation. doi:10.1007/s10534-026-00818-6 | 2026 |
| Mycobacterium tuberculosis H37Rv Short Linear PDZ-Binding Motif Proteins at the Host-Pathogen Interface. doi:10.3390/ijms27073153 | 2026 |
| Mining the CD4 antigen repertoire for next-generation tuberculosis vaccines. doi:10.1016/j.cell.2025.08.027 | 2025 |
| Phagosomal escape and sabotage: The role of ESX-1 and PDIMs in Mycobacterium tuberculosis pathogenesis. doi:10.1080/08830185.2025.2531828 | 2025 |
| Crosstalk between cyclic-di-guanosine monophosphate and the sensor kinase MtrB regulates MtrA-dependent genes, bacterial growth, biofilm formation and lysosomal trafficking of Mycobacterium tuberculosis. doi:10.1099/mic.0.001532 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
IdeR (ideR), Zur (zur).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
Post-translational modifications
1 reported modified residue(s):
N-acetylserine @2.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -6.33 (95% CI -7.86 to -4.78). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0295
· 100.0% identity |
|---|---|
| M. leprae |
ML2532c
· 76.8% identity |
| M. marinum |
MMAR_0546
· 91.8% identity |
| M. smegmatis |
MSMEG_0620
· 77.1% identity |
| M. orygis |
RJtmp_000305
· 100.0% identity |
| M. abscessus |
MAB_2229c
· 76.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53692
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESAT-6-like protein EsxG |
| Curated function | EsxG, in complex with EsxH, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery. EsxG stabilizes EsxH in the host cytosol. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Preferred name | esxG |
|---|---|
| Orthologous group | 2A0FY |
| Gene Ontology (2) |
GO:0005575, GO:0005576
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacteriaceae
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 86.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Mycobacteriaceae) · mean identity 76.0% detected in the sister family Mycobacteriaceae (M. abscessus) but not in the broader Corynebacteriales — a Mycobacteriaceae-restricted gene (single-genome rung: interpret with care) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) GD — not strictly essential
| DeJesus 2017 call | GD · growth-defect |
|---|---|
| What the call means | growth-defect: insertions tolerated but fitness reduced; NOT essential |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 5 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.200, mean read count 17. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | `essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality. Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0287-esxG_TetOn2.3 (TetON promoter 2) |
|---|---|
| Baseline knockdown fitness | 3.954 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1327.0 ppm · rank 164/3519 (95.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 97 aa |
|---|---|
| Molecular weight | 9.8 kDa |
| Theoretical pI | 5.99 |
| GRAVY | 0.299 (hydrophobic) |
| Aliphatic index | 82.1 |
| Aromaticity | 0.072 |
| Instability index | 29.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WXG100 | PF06013.19 | 1.0e-06 | 10–87 | Proteins of 100 residues with WXG |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2kg7 |
Solution NMR | — | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3fav-assembly2_C |
1.00 | 0.90 | 1.9e-03 sig | 3fav-assembly2_C Structure of the CFP10-ESAT6 complex from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 83.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 11
| Upstream (5' on genome) | PPE4 (+ strand, 48 bp gap) |
|---|---|
| Downstream (3' on genome) | esxH (+ strand, 29 bp gap) |
| Predicted operon |
eccA3 · eccB3 · eccC3 · PE5 · PPE4 · esxG · esxH · espG3 · eccD3 · mycP3 · eccE3
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: esxH (ESAT-6-like protein EsxH), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0288 esxH exp |
ESAT-6-like protein EsxH | 999 | 1000 ctx | neighborhood:727 coexpression:860 experimental:993 textmining:993 |
Rv0289 espG3 |
ESX-3 secretion-associated protein EspG3 | 974 | 940 ctx | neighborhood:707 coexpression:802 textmining:595 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 951 | 885 ctx | neighborhood:592 coexpression:730 textmining:594 |
Rv3019c esxR exp |
ESAT-6 like protein EsxR | 956 | 833 | experimental:822 textmining:751 |
Rv3017c esxQ exp |
ESAT-6 like protein EsxQ | 915 | 833 | experimental:822 textmining:517 |
Rv0286 PPE4 |
PPE family protein PPE4 | 932 | 755 ctx | neighborhood:644 textmining:736 |
Rv0291 mycP3 |
membrane-anchored mycosin MycP | 726 | 687 ctx | neighborhood:592 |
Rv0292 eccE3 |
ESX-3 secretion system protein EccE | 824 | 685 ctx | neighborhood:592 textmining:467 |
Rv0283 eccB3 |
ESX-3 secretion system protein EccB3 | 817 | 681 ctx | neighborhood:663 textmining:454 |
Rv0284 eccC3 |
ESX-3 secretion system protein EccC3 | 797 | 681 ctx | neighborhood:663 |
Rv0282 eccA3 |
ESX-3 secretion system protein EccA | 770 | 678 ctx | neighborhood:663 |
Rv0285 PE5 |
PE family protein PE5 | 912 | 663 ctx | neighborhood:663 textmining:752 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 927 | 549 | textmining:846 |
Rv1038c esxJ |
ESAT-6 like protein EsxJ | 667 | 512 | |
Rv3875 esxA |
ESAT-6 protein EsxA | 867 | 468 | textmining:761 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESAT-6 like protein EsxG
- MTBC0 PGAP product: type VII secretion system protein EsxG
- Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=1e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214801.1)
- Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2A0FY - Curated reference: UniProt O53692 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
esxH - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000306|Rv0287|esxG MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for esxG? Email the maintainer — the message is pre-filled with this gene's details.