esxG Resolved · high auto-curated
H37Rv Rv0287 · MTBC0 mtbc0_000306 ·
97 aa · 354819–355112 (+) ·
RefSeq NP_214801.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxG |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system protein EsxG |
| Revised (this work) | Type VII secretion system protein EsxG. Pfam: WXG100 (PF06013.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53692
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESAT-6-like protein EsxG |
| Curated function | EsxG, in complex with EsxH, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery. EsxG stabilizes EsxH in the host cytosol. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Preferred name | esxG |
|---|---|
| Orthologous group | 2A0FY |
| Gene Ontology (2) |
GO:0005575, GO:0005576
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WXG100 | PF06013.19 | 1.0e-06 | 10–87 | Proteins of 100 residues with WXG |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: esxH (ESAT-6-like protein EsxH), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0288 esxH |
ESAT-6-like protein EsxH | 999 | 1000 ctx | neighborhood:727 coexpression:860 experimental:993 textmining:993 |
Rv0289 espG3 |
ESX-3 secretion-associated protein EspG3 | 974 | 940 ctx | neighborhood:707 coexpression:802 textmining:595 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 951 | 885 ctx | neighborhood:592 coexpression:730 textmining:594 |
Rv3019c esxR |
ESAT-6 like protein EsxR | 956 | 833 | experimental:822 textmining:751 |
Rv3017c esxQ |
ESAT-6 like protein EsxQ | 915 | 833 | experimental:822 textmining:517 |
Rv0286 PPE4 |
PPE family protein PPE4 | 932 | 755 ctx | neighborhood:644 textmining:736 |
Rv0291 mycP3 |
membrane-anchored mycosin MycP | 726 | 687 ctx | neighborhood:592 |
Rv0292 eccE3 |
ESX-3 secretion system protein EccE | 824 | 685 ctx | neighborhood:592 textmining:467 |
Rv0283 eccB3 |
ESX-3 secretion system protein EccB3 | 817 | 681 ctx | neighborhood:663 textmining:454 |
Rv0284 eccC3 |
ESX-3 secretion system protein EccC3 | 797 | 681 ctx | neighborhood:663 |
Rv0282 eccA3 |
ESX-3 secretion system protein EccA | 770 | 678 ctx | neighborhood:663 |
Rv0285 PE5 |
PE family protein PE5 | 912 | 663 ctx | neighborhood:663 textmining:752 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 927 | 549 | textmining:846 |
Rv1038c esxJ |
ESAT-6 like protein EsxJ | 667 | 512 | |
Rv3875 esxA |
ESAT-6 protein EsxA | 867 | 468 | textmining:761 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESAT-6 like protein EsxG
- MTBC0 PGAP product: type VII secretion system protein EsxG
- Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=1e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214801.1)
- Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2A0FY - Curated reference: UniProt O53692 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
esxH - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000306|Rv0287|esxG MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF