esxI Resolved · high auto-curated

H37Rv Rv1037c · MTBC0 mtbc0_001114 · 94 aa · 1167881–1168165 (-) · RefSeq NP_215553.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxI
MTBC0 PGAP re-annotationtype VII secretion system protein EsxV
Revised (this work)Type VII secretion system ESX-5 protein EsxL. Pfam: WXG100 (PF06013.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P0DOA6 SwissProt · reviewed · Evidence at transcript level
UniProt nameESAT-6-like protein EsxI

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBelongs to the WXG100 family
Orthologous group2BPBT

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.19 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 6.7e-143–87 Proteins of 100 residues with WXG

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxJ (ESAT-6 like protein EsxJ), high confidence from genomic context alone (score 940 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3620c esxW ESAT-6 like protein EsxW 955 942 coexpression:799 experimental:715
Rv1038c esxJ ESAT-6 like protein EsxJ 981 940 ctx neighborhood:703 coexpression:805 textmining:711
Rv3619c esxV ESAT-6 like protein EsxV 833 833 coexpression:833
Rv2346c esxO ESAT-6 like protein EsxO 829 829 coexpression:829
Rv2347c esxP ESAT-6 like protein EsxP 870 805 coexpression:798
Rv1793 esxN ESAT-6 like protein EsxN 806 805 coexpression:805
Rv1198 esxL ESAT-6 like protein EsxL 804 803 coexpression:803
Rv3648c cspA cold shock protein A 801 802 coexpression:799
Rv1197 esxK ESAT-6 like protein EsxK 922 767 coexpression:759 textmining:680
Rv3875 esxA ESAT-6 protein EsxA 823 748 coexpression:748
Rv0641 rplA 50S ribosomal protein L1 729 729 coexpression:729
Rv1036c Rv1036c, (MTCY10G2.13), len: 112 aa. Probable IS1560 transposase fragment, similar to part of Rv3386|E1202304|MTV004.44 (234 aa) (82.8% iden 531 531 ctx neighborhood:531
Rv1035c Probable transposase (fragment); Rv1035c, (MTCY10G2.14), len: 228 aa. Probable IS1560 transposase fragment, similar to parts of Rv3387|E1202 463 464 ctx neighborhood:462
Rv1039c PPE15 PPE family protein PPE15 566 450 ctx neighborhood:447
Rv3874 esxB ESAT-6-like protein EsxB 565 423 coexpression:423

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6 like protein EsxI
  • MTBC0 PGAP product: type VII secretion system ESX-5 protein EsxL
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=7e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215553.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BPBT
  • Curated reference: UniProt P0DOA6 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor esxJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001114|Rv1037c|esxI
MTINYQFGDVDAHGAMIRALAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA