esxI Resolved · high auto-curated
H37Rv Rv1037c · MTBC0 mtbc0_001114 ·
94 aa · 1167881–1168165 (-) ·
RefSeq NP_215553.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxI |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system protein EsxV |
| Revised (this work) | Type VII secretion system ESX-5 protein EsxL. Pfam: WXG100 (PF06013.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P0DOA6
SwissProt · reviewed
· Evidence at transcript level
|
|---|---|
| UniProt name | ESAT-6-like protein EsxI |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Belongs to the WXG100 family |
| Orthologous group | 2BPBT |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.19 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WXG100 | PF06013.19 | 6.7e-14 | 3–87 | Proteins of 100 residues with WXG |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: esxJ (ESAT-6 like protein EsxJ), high confidence from genomic context alone (score 940 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3620c esxW |
ESAT-6 like protein EsxW | 955 | 942 | coexpression:799 experimental:715 |
Rv1038c esxJ |
ESAT-6 like protein EsxJ | 981 | 940 ctx | neighborhood:703 coexpression:805 textmining:711 |
Rv3619c esxV |
ESAT-6 like protein EsxV | 833 | 833 | coexpression:833 |
Rv2346c esxO |
ESAT-6 like protein EsxO | 829 | 829 | coexpression:829 |
Rv2347c esxP |
ESAT-6 like protein EsxP | 870 | 805 | coexpression:798 |
Rv1793 esxN |
ESAT-6 like protein EsxN | 806 | 805 | coexpression:805 |
Rv1198 esxL |
ESAT-6 like protein EsxL | 804 | 803 | coexpression:803 |
Rv3648c cspA |
cold shock protein A | 801 | 802 | coexpression:799 |
Rv1197 esxK |
ESAT-6 like protein EsxK | 922 | 767 | coexpression:759 textmining:680 |
Rv3875 esxA |
ESAT-6 protein EsxA | 823 | 748 | coexpression:748 |
Rv0641 rplA |
50S ribosomal protein L1 | 729 | 729 | coexpression:729 |
Rv1036c |
Rv1036c, (MTCY10G2.13), len: 112 aa. Probable IS1560 transposase fragment, similar to part of Rv3386|E1202304|MTV004.44 (234 aa) (82.8% iden | 531 | 531 ctx | neighborhood:531 |
Rv1035c |
Probable transposase (fragment); Rv1035c, (MTCY10G2.14), len: 228 aa. Probable IS1560 transposase fragment, similar to parts of Rv3387|E1202 | 463 | 464 ctx | neighborhood:462 |
Rv1039c PPE15 |
PPE family protein PPE15 | 566 | 450 ctx | neighborhood:447 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 565 | 423 | coexpression:423 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESAT-6 like protein EsxI
- MTBC0 PGAP product: type VII secretion system ESX-5 protein EsxL
- Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=7e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215553.1)
- Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BPBT - Curated reference: UniProt P0DOA6 (SwissProt, reviewed; Evidence at transcript level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
esxJ - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001114|Rv1037c|esxI MTINYQFGDVDAHGAMIRALAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA