Rv1191 Family assigned · medium auto-curated

H37Rv Rv1191 · MTBC0 mtbc0_001279 · 304 aa · 1342373–1343287 (+) · RefSeq NP_215707.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05293 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionAlpha beta hydrolase
Orthologous groupCOG0596

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.104 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (170) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 2.7e-1135–282 alpha/beta hydrolase fold
Hydrolase_4PF12146.16 7.4e-0858–280 Serine aminopeptidase, S33

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD36 (fatty-acid--CoA ligase FadD36), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1192 hyp hypothetical protein 784 784 ctx neighborhood:783
Rv1193 fadD36 fatty-acid--CoA ligase FadD36 778 778 ctx neighborhood:746
Rv1190 hyp hypothetical protein 631 630 ctx neighborhood:621
Rv0138 hyp hypothetical protein 609 609 ctx cooccurence:609
Rv1189 sigI ECF RNA polymerase sigma factor SigI 553 553 ctx neighborhood:546
Rv1874 hyp hypothetical protein 552 553 ctx cooccurence:550
Rv1902c nanT sialic acid-transport integral membrane protein NanT 550 550 ctx neighborhood:544
Rv1900c lipJ lignin peroxidase LipJ 512 512 ctx neighborhood:510
Rv2048c pks12 polyketide synthase 529 501 experimental:441
Rv1527c pks5 polyketide synthase 529 501 experimental:441
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 528 501 experimental:441
Rv2940c mas multifunctional mycocerosic acid synthase 527 500 experimental:441
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 526 498 experimental:441
Rv1186c hyp hypothetical protein 456 456
Rv2946c pks1 polyketide synthase 486 455

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=3e-11), Hydrolase_4 PF12146.16 (E=7e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215707.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0596
  • Curated reference: UniProt O05293 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor fadD36
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001279|Rv1191|
MAVAIARPKLEGNIAVGEDRRIGFAEFGAPQGRAVFWLHGTPGARRQIPTEARVYAEHHNIRLIGVDRPGIGASTPHQYETILAFADDLRTIADTLGIDKMAVVGLSGGGPYTLACAAGLPDRVVAAGVLGGVAPTRGPDAISGGLMRLGSAVAPLLQVGGTPLRLGASLLIRAARPVASPALDLYGLLSPRADRHLLARPEFKAMFLDDLLNGSRKQLAAPFADVIAFARDWGFRLDEVKVPVRWWHGDHDHIVPFSHGEHVVSRLPDAKLLHLPGESHLAGLGRGEEILSTLMQIWDRDLRK