Rv1191 Family assigned · medium auto-curated
H37Rv Rv1191 · MTBC0 mtbc0_001279 ·
304 aa ·
1342373–1343287 MTBC0
(+) ·
RefSeq NP_215707.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta hydrolase |
| Revised (this work) | Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
Found under: H37Rv (1).
1 TB publication mentions this gene. 1 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Functional characterization of hypothetical proteins of Mycobacterium tuberculosis with possible esterase/lipase signature: a cumulative in silico and in vitro approach. doi:10.1080/07391102.2016.1174738 | 2017 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.88 (95% CI -0.93 to 3.88). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1223
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_4245
· 89.4% identity |
| M. smegmatis |
MSMEG_3508
· 77.3% identity |
| M. orygis |
RJtmp_001257
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O05293
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Alpha beta hydrolase |
| Orthologous group | COG0596 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.104 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (170) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 5 consensus substitution(s) low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 81.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 2/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 67.8% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 108.111111111. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 110.0 ppm · rank 1222/3519 (65.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 304 aa |
|---|---|
| Molecular weight | 32.6 kDa |
| Theoretical pI | 8.79 |
| GRAVY | 0.034 (hydrophobic) |
| Aliphatic index | 102.1 |
| Aromaticity | 0.062 |
| Instability index | 39.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Abhydrolase_1 | PF00561.27 | 2.7e-11 | 35–282 | alpha/beta hydrolase fold |
Hydrolase_4 | PF12146.16 | 7.4e-08 | 58–280 | Serine aminopeptidase, S33 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4uhe-assembly1_A |
1.00 | 0.69 | 1.9e-15 sig | 4uhe-assembly1_A Structural studies of a thermophilic esterase from Thermogutta terrifontis (malate bound) |
8ynv-assembly4_D |
1.00 | 0.69 | 3.0e-15 sig | 8ynv-assembly4_D Poly(3-hydroxybutyrate) depolymerase PhaZ from Bacillus thuringiensis |
8ynw-assembly4_D |
1.00 | 0.70 | 5.6e-15 sig | 8ynw-assembly4_D S102A mutant of poly(3-hydroxybutyrate) depolymerase PhaZ from Bacillus thuringiensis |
4y7d-assembly1_A |
1.00 | 0.68 | 3.5e-15 sig | 4y7d-assembly1_A Alpha/beta hydrolase fold protein from Nakamurella multipartita |
3v1l-assembly1_A |
1.00 | 0.69 | 8.0e-14 sig | 3v1l-assembly1_A Crystal Structure of the S112A/H265Q mutant of a C-C hydrolase, BphD from Burkholderia xenovorans LB400 |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv1190 (+ strand, 72 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1192 (+ strand, 81 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
csoR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: fadD36 (fatty-acid--CoA ligase FadD36), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1192 hyp |
hypothetical protein | 784 | 784 ctx | neighborhood:783 |
Rv1193 fadD36 |
fatty-acid--CoA ligase FadD36 | 778 | 778 ctx | neighborhood:746 |
Rv1190 hyp |
hypothetical protein | 631 | 630 ctx | neighborhood:621 |
Rv0138 hyp |
hypothetical protein | 609 | 609 ctx | cooccurence:609 |
Rv1189 sigI |
ECF RNA polymerase sigma factor SigI | 553 | 553 ctx | neighborhood:546 |
Rv1874 hyp |
hypothetical protein | 552 | 553 ctx | cooccurence:550 |
Rv1902c nanT |
sialic acid-transport integral membrane protein NanT | 550 | 550 ctx | neighborhood:544 |
Rv1900c lipJ |
lignin peroxidase LipJ | 512 | 512 ctx | neighborhood:510 |
Rv2048c pks12 exp |
polyketide synthase | 529 | 501 | experimental:441 |
Rv1527c pks5 exp |
polyketide synthase | 529 | 501 | experimental:441 |
Rv3825c pks2 exp |
phthioceranic/hydroxyphthioceranic acid synthase | 528 | 501 | experimental:441 |
Rv2940c mas exp |
multifunctional mycocerosic acid synthase | 527 | 500 | experimental:441 |
Rv2933 ppsC exp |
phthiocerol synthesis polyketide synthase type I PpsC | 526 | 498 | experimental:441 |
Rv1186c hyp |
hypothetical protein | 456 | 456 | |
Rv2946c pks1 |
polyketide synthase | 486 | 455 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: alpha/beta hydrolase
- Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=3e-11), Hydrolase_4 PF12146.16 (E=7e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215707.1)
- Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0596 - Curated reference: UniProt O05293 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
fadD36 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001279|Rv1191| MAVAIARPKLEGNIAVGEDRRIGFAEFGAPQGRAVFWLHGTPGARRQIPTEARVYAEHHNIRLIGVDRPGIGASTPHQYETILAFADDLRTIADTLGIDKMAVVGLSGGGPYTLACAAGLPDRVVAAGVLGGVAPTRGPDAISGGLMRLGSAVAPLLQVGGTPLRLGASLLIRAARPVASPALDLYGLLSPRADRHLLARPEFKAMFLDDLLNGSRKQLAAPFADVIAFARDWGFRLDEVKVPVRWWHGDHDHIVPFSHGEHVVSRLPDAKLLHLPGESHLAGLGRGEEILSTLMQIWDRDLRK
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1191? Email the maintainer — the message is pre-filled with this gene's details.