Rv1191 Family assigned · medium auto-curated
H37Rv Rv1191 · MTBC0 mtbc0_001279 ·
304 aa · 1342373–1343287 (+) ·
RefSeq NP_215707.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta hydrolase |
| Revised (this work) | Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05293
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Alpha beta hydrolase |
| Orthologous group | COG0596 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.104 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (170) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Abhydrolase_1 | PF00561.27 | 2.7e-11 | 35–282 | alpha/beta hydrolase fold |
Hydrolase_4 | PF12146.16 | 7.4e-08 | 58–280 | Serine aminopeptidase, S33 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadD36 (fatty-acid--CoA ligase FadD36), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1192 hyp |
hypothetical protein | 784 | 784 ctx | neighborhood:783 |
Rv1193 fadD36 |
fatty-acid--CoA ligase FadD36 | 778 | 778 ctx | neighborhood:746 |
Rv1190 hyp |
hypothetical protein | 631 | 630 ctx | neighborhood:621 |
Rv0138 hyp |
hypothetical protein | 609 | 609 ctx | cooccurence:609 |
Rv1189 sigI |
ECF RNA polymerase sigma factor SigI | 553 | 553 ctx | neighborhood:546 |
Rv1874 hyp |
hypothetical protein | 552 | 553 ctx | cooccurence:550 |
Rv1902c nanT |
sialic acid-transport integral membrane protein NanT | 550 | 550 ctx | neighborhood:544 |
Rv1900c lipJ |
lignin peroxidase LipJ | 512 | 512 ctx | neighborhood:510 |
Rv2048c pks12 |
polyketide synthase | 529 | 501 | experimental:441 |
Rv1527c pks5 |
polyketide synthase | 529 | 501 | experimental:441 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 528 | 501 | experimental:441 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 527 | 500 | experimental:441 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 526 | 498 | experimental:441 |
Rv1186c hyp |
hypothetical protein | 456 | 456 | |
Rv2946c pks1 |
polyketide synthase | 486 | 455 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: alpha/beta hydrolase
- Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=3e-11), Hydrolase_4 PF12146.16 (E=7e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215707.1)
- Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0596 - Curated reference: UniProt O05293 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
fadD36 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001279|Rv1191| MAVAIARPKLEGNIAVGEDRRIGFAEFGAPQGRAVFWLHGTPGARRQIPTEARVYAEHHNIRLIGVDRPGIGASTPHQYETILAFADDLRTIADTLGIDKMAVVGLSGGGPYTLACAAGLPDRVVAAGVLGGVAPTRGPDAISGGLMRLGSAVAPLLQVGGTPLRLGASLLIRAARPVASPALDLYGLLSPRADRHLLARPEFKAMFLDDLLNGSRKQLAAPFADVIAFARDWGFRLDEVKVPVRWWHGDHDHIVPFSHGEHVVSRLPDAKLLHLPGESHLAGLGRGEEILSTLMQIWDRDLRK