esxO Resolved · high auto-curated

H37Rv Rv2346c · MTBC0 mtbc0_002498 · 94 aa · 2650638–2650922 (-) · RefSeq NP_216862.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxO
MTBC0 PGAP re-annotationtype VII secretion system effector EsxO
Revised (this work)Type VII secretion system effector EsxO. Pfam: WXG100 (PF06013.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNI7 SwissProt · reviewed · Evidence at protein level
UniProt nameESAT-6-like protein EsxO
Curated functionPlays an important role in mycobacterial pathogenesis in the context of innate immunity. Aids host cell invasion and intracellular bacillary persistence. Increases host oxidative stress response, leading to genomic instability and decrease in macrophage viability. Also induces autophagy and modulates the immune function of macrophages.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameesxO
eggNOG descriptionBelongs to the WXG100 family
Orthologous group2BPBT
Gene Ontology (9) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.189 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 2.8e-153–87 Proteins of 100 residues with WXG

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxP (ESAT-6 like protein EsxP), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2347c esxP ESAT-6 like protein EsxP 999 994 ctx neighborhood:630 coexpression:860 experimental:900 textmining:929
Rv1197 esxK ESAT-6 like protein EsxK 964 865 coexpression:860 textmining:746
Rv1038c esxJ ESAT-6 like protein EsxJ 954 865 coexpression:860 textmining:679
Rv3620c esxW ESAT-6 like protein EsxW 954 865 coexpression:860 textmining:676
Rv1793 esxN ESAT-6 like protein EsxN 912 860 coexpression:860 textmining:400
Rv1198 esxL ESAT-6 like protein EsxL 911 860 coexpression:860
Rv3619c esxV ESAT-6 like protein EsxV 861 860 coexpression:860
Rv1037c esxI ESAT-6 like protein EsxI 829 829 coexpression:829
Rv3648c cspA cold shock protein A 841 808 coexpression:806
Rv3875 esxA ESAT-6 protein EsxA 921 802 coexpression:802 textmining:621
Rv3874 esxB ESAT-6-like protein EsxB 899 796 coexpression:796 textmining:530
Rv1196 PPE18 PPE family protein PPE18 778 733 coexpression:733
Rv1872c lldD2 L-lactate dehydrogenase 766 733 coexpression:733
Rv0685 tuf elongation factor Tu 731 731 coexpression:731
Rv1871c hyp hypothetical protein 730 730 coexpression:730

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6 like protein EsxO
  • MTBC0 PGAP product: type VII secretion system effector EsxO
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=3e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216862.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BPBT
  • Curated reference: UniProt P9WNI7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor esxP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002498|Rv2346c|esxO
MTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA