lldD2 Resolved · high auto-curated

H37Rv Rv1872c · MTBC0 mtbc0_001985 · 414 aa · 2139946–2141190 (-) · RefSeq NP_216388.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)L-lactate dehydrogenase
MTBC0 PGAP re-annotationquinone-dependent L-lactate dehydrogenase
Revised (this work)Quinone-dependent L-lactate dehydrogenase. Pfam: FMN_dh (PF01070.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WND5 SwissProt · reviewed · Evidence at protein level
UniProt namePutative L-lactate dehydrogenase
EC (curated) EC 1.1.-.-

UniProt still lists this protein as Putative L-lactate dehydrogenase; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namelldD2
eggNOG descriptionDehydrogenase
Orthologous groupCOG1304
EC number EC 1.1.2.3, EC 1.1.3.15
KEGG orthology K00101, K00104
KEGG pathways map00620, map00630, map01100, map01110, map01120, map01130
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.592 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 13 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FMN_dhPF01070.25 3.2e-12644–402 FMN-dependent dehydrogenase

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1871c hyp hypothetical protein 965 964 ctx neighborhood:750 coexpression:862
Rv1617 pykA pyruvate kinase 938 932 database:900
Rv0694 mftD mycofactocin system heme/flavin oxidoreductase MftD 936 920 database:900
Rv2967c pca pyruvate carboxylase 911 906 database:900
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 929 904 database:900
Rv2332 mez malate oxidoreductase 915 903 database:900
Rv2497c bkdA 3-methyl-2-oxobutanoate dehydrogenase subunit alpha 906 903 database:900
Rv2454c korB 2-oxoglutarate oxidoreductase subunit KorB 910 902 database:900
Rv2241 aceE pyruvate dehydrogenase E1 component 910 901 database:900
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 904 901 database:900
Rv1127c ppdK pyruvate, phosphate dikinase PpdK 906 900 database:900
Rv3003c ilvB1 acetolactate synthase large subunit IlvB 904 899 database:893
Rv3509c ilvX acetohydroxyacid synthase large subunit 904 899 database:893
Rv1820 ilvG acetolactate synthase large subunit IlvG 904 899 database:893
Rv3470c ilvB2 acetolactate synthase large subunit 911 898 database:893

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: L-lactate dehydrogenase
  • MTBC0 PGAP product: quinone-dependent L-lactate dehydrogenase
  • Pfam (hmmscan --cut_ga): FMN_dh PF01070.25 (E=3e-126)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216388.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FMN_dh (PF01070.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1304
  • Curated reference: UniProt P9WND5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 141 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001985|Rv1872c|lldD2
MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGAAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRAAAAGFDTMLVTVDVPVAGARLRDVRNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSNHGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT