lldD2 Resolved · high auto-curated
H37Rv Rv1872c · MTBC0 mtbc0_001985 ·
414 aa ·
2139946–2141190 MTBC0
(-) ·
RefSeq NP_216388.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | L-lactate dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | quinone-dependent L-lactate dehydrogenase |
| Revised (this work) | Quinone-dependent L-lactate dehydrogenase. Pfam: FMN_dh (PF01070.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 5 publications
5 TB publications mention this gene. 5 publication(s) discuss this gene (5 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Differential expression of genes associated with lipid import, β-oxidation and lactate oxidation induced by Mycobacterium tuberculosis curli pili in broth culture compared to intracellular bacilli within THP-1 macrophages. doi:10.1099/jmm.0.001994 | 2025 |
| Ongoing evolution of the Mycobacterium tuberculosis lactate dehydrogenase reveals the pleiotropic effects of bacterial adaption to host pressure. doi:10.1371/journal.ppat.1012050 | 2024 |
| Ongoing evolution of the Mycobacterium tuberculosis lactate dehydrogenase reveals the pleiotropic effects of bacterial adaption to host pressure. doi:10.1101/2023.10.09.561592 | 2023 |
| Lactate oxidation facilitates growth of Mycobacterium tuberculosis in human macrophages. doi:10.1038/s41598-017-05916-7 | 2017 |
| Evidence for diversifying selection in a set of Mycobacterium tuberculosis genes in response to antibiotic- and nonantibiotic-related pressure. doi:10.1093/molbev/mst038 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.70 (95% CI -0.75 to 5.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in respiration; catalyzes conversion of lactate into pyruvate [catalytic activity: (S)-lactate + 2 ferricytochrome C = pyruvate + 2 ferrocytochrome C]. |
|---|---|
| Mycobrowser EC |
1.1.2.3
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1903c
· 99.5% identity |
|---|---|
| M. leprae |
ML2046
· 85.0% identity |
| M. marinum |
MMAR_2752
· 87.2% identity |
| M. orygis |
RJtmp_001940
· 99.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WND5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative L-lactate dehydrogenase |
| EC (curated) |
EC 1.1.-.-
|
UniProt still lists this protein as Putative L-lactate dehydrogenase; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | lldD2 |
| eggNOG description | Dehydrogenase |
| Orthologous group | COG1304 |
| EC number |
EC 1.1.2.3, EC 1.1.3.15
|
| KEGG orthology |
K00101, K00104
|
| KEGG pathways |
map00620, map00630, map01100, map01110, map01120, map01130
|
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.592 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 8 synonymous, 13 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.365 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 84.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 51.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 14 in the ORF — 0 in the essential state, 0 growth-defect, 8 non-essential, 6 growth-advantage. Saturation 1.000, mean read count 195.142857143. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) carbon source
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| Sodium L-Lactate | carbon source | mutant depleted (gene required) | -2.469 | -8.828 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 2960.0 ppm · rank 34/3519 (99.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 414 aa |
|---|---|
| Molecular weight | 45.3 kDa |
| Theoretical pI | 9.76 |
| GRAVY | 0.058 (hydrophobic) |
| Aliphatic index | 100.4 |
| Aromaticity | 0.068 |
| Instability index | 48.1 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FMN_dh | PF01070.25 | 3.2e-126 | 44–402 | FMN-dependent dehydrogenase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6bfg-assembly1_A |
1.00 | 0.94 | 1.8e-38 sig | 6bfg-assembly1_A Crystal structure of monotopic membrane protein (S)-mandelate dehydrogenase |
5qie-assembly1_A |
1.00 | 0.94 | 2.6e-37 sig | 5qie-assembly1_A PanDDA analysis group deposition of models with modelled events (e.g. bound ligands) -- Crystal Structure of HAO1 in complex with Z2856434894 |
7m2o-assembly1_A |
1.00 | 0.96 | 2.7e-36 sig | 7m2o-assembly1_A Crystal structure of Human Glycolate Oxidase with Inhibitor Compound 15 |
7r4o-assembly1_A |
1.00 | 0.96 | 2.0e-36 sig | 7r4o-assembly1_A Structure of human hydroxyacid oxidase 1 bound with 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one |
7r4p-assembly1_A |
1.00 | 0.96 | 1.5e-36 sig | 7r4p-assembly1_A Structure of human hydroxyacid oxidase 1 bound with 6-amino-1-benzyl-5-(methylamino)pyrimidine-2,4(1H,3H)-dione |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv1871c (- strand, 22 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1873 (+ strand, 22 bp gap) |
| Predicted operon |
Rv1871c · lldD2
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1871c hyp |
hypothetical protein | 965 | 964 ctx | neighborhood:750 coexpression:862 |
Rv1617 pykA exp |
pyruvate kinase | 938 | 932 | database:900 |
Rv0694 mftD exp |
mycofactocin system heme/flavin oxidoreductase MftD | 936 | 920 | database:900 |
Rv2967c pca exp |
pyruvate carboxylase | 911 | 906 | database:900 |
Rv2455c korA exp |
2-oxoglutarate oxidoreductase subunit KorA | 929 | 904 | database:900 |
Rv2332 mez exp |
malate oxidoreductase | 915 | 903 | database:900 |
Rv2497c bkdA exp |
3-methyl-2-oxobutanoate dehydrogenase subunit alpha | 906 | 903 | database:900 |
Rv2454c korB exp |
2-oxoglutarate oxidoreductase subunit KorB | 910 | 902 | database:900 |
Rv2241 aceE exp |
pyruvate dehydrogenase E1 component | 910 | 901 | database:900 |
Rv2496c bkdB exp |
3-methyl-2-oxobutanoate dehydrogenase subunit beta | 904 | 901 | database:900 |
Rv1127c ppdK exp |
pyruvate, phosphate dikinase PpdK | 906 | 900 | database:900 |
Rv3003c ilvB1 exp |
acetolactate synthase large subunit IlvB | 904 | 899 | database:893 |
Rv3509c ilvX exp |
acetohydroxyacid synthase large subunit | 904 | 899 | database:893 |
Rv1820 ilvG exp |
acetolactate synthase large subunit IlvG | 904 | 899 | database:893 |
Rv3470c ilvB2 exp |
acetolactate synthase large subunit | 911 | 898 | database:893 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: L-lactate dehydrogenase
- MTBC0 PGAP product: quinone-dependent L-lactate dehydrogenase
- Pfam (hmmscan --cut_ga): FMN_dh PF01070.25 (E=3e-126)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216388.1)
- Domains: Pfam-A via hmmscan --cut_ga — FMN_dh (PF01070.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1304 - Curated reference: UniProt P9WND5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 141 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001985|Rv1872c|lldD2 MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGAAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRAAAAGFDTMLVTVDVPVAGARLRDVRNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSNHGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lldD2? Email the maintainer — the message is pre-filled with this gene's details.