esxL Resolved · high auto-curated
H37Rv Rv1198 · MTBC0 mtbc0_001286 ·
94 aa · 1349448–1349732 (+) ·
RefSeq NP_215714.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxL |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system ESX-5 protein EsxL |
| Revised (this work) | Type VII secretion system ESX-5 protein EsxL. Pfam: WXG100 (PF06013.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNJ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESAT-6-like protein EsxL |
| Curated function | Induces apoptosis of host cells. Is immunogenic with highly specific seroreactivity towards TB patients' serum. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | esxL |
| eggNOG description | Belongs to the WXG100 family |
| Orthologous group | 2BPBT |
| Gene Ontology (9) |
GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.247 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 9 synonymous, 7 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.78% of strains (1135) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WXG100 | PF06013.19 | 2.6e-14 | 3–87 | Proteins of 100 residues with WXG |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: esxK (ESAT-6 like protein EsxK), high confidence from genomic context alone (score 945 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1197 esxK |
ESAT-6 like protein EsxK | 993 | 945 ctx | neighborhood:626 coexpression:860 textmining:878 |
Rv1196 PPE18 |
PPE family protein PPE18 | 941 | 878 ctx | neighborhood:419 coexpression:799 textmining:535 |
Rv1038c esxJ |
ESAT-6 like protein EsxJ | 954 | 865 | coexpression:860 textmining:679 |
Rv2347c esxP |
ESAT-6 like protein EsxP | 920 | 865 | coexpression:860 textmining:438 |
Rv3620c esxW |
ESAT-6 like protein EsxW | 894 | 865 | coexpression:860 |
Rv1793 esxN |
ESAT-6 like protein EsxN | 911 | 860 | coexpression:860 |
Rv2346c esxO |
ESAT-6 like protein EsxO | 911 | 860 | coexpression:860 |
Rv3619c esxV |
ESAT-6 like protein EsxV | 860 | 860 | coexpression:860 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 901 | 803 | coexpression:803 textmining:521 |
Rv1037c esxI |
ESAT-6 like protein EsxI | 804 | 803 | coexpression:803 |
Rv3648c cspA |
cold shock protein A | 802 | 803 | coexpression:800 |
Rv3875 esxA |
ESAT-6 protein EsxA | 927 | 799 | coexpression:799 textmining:652 |
Rv0287 esxG |
ESAT-6 like protein EsxG | 545 | 427 | |
Rv3020c esxS |
ESAT-6 like protein EsxS | 546 | 394 | |
Rv3894c eccC2 |
ESX-2 type VII secretion system protein EccC | 488 | 353 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESAT-6 like protein EsxL
- MTBC0 PGAP product: type VII secretion system ESX-5 protein EsxL
- Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=3e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215714.1)
- Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BPBT - Curated reference: UniProt P9WNJ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
esxK - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001286|Rv1198|esxL MTINYQFGDVDDHGAMIRAQAGLLEAEHQAIIRDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA