esxL Resolved · high auto-curated

H37Rv Rv1198 · MTBC0 mtbc0_001286 · 94 aa · 1349448–1349732 (+) · RefSeq NP_215714.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxL
MTBC0 PGAP re-annotationtype VII secretion system ESX-5 protein EsxL
Revised (this work)Type VII secretion system ESX-5 protein EsxL. Pfam: WXG100 (PF06013.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNJ5 SwissProt · reviewed · Evidence at protein level
UniProt nameESAT-6-like protein EsxL
Curated functionInduces apoptosis of host cells. Is immunogenic with highly specific seroreactivity towards TB patients' serum.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameesxL
eggNOG descriptionBelongs to the WXG100 family
Orthologous group2BPBT
Gene Ontology (9) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.247 · purifying
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 7 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.78% of strains (1135) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 2.6e-143–87 Proteins of 100 residues with WXG

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxK (ESAT-6 like protein EsxK), high confidence from genomic context alone (score 945 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1197 esxK ESAT-6 like protein EsxK 993 945 ctx neighborhood:626 coexpression:860 textmining:878
Rv1196 PPE18 PPE family protein PPE18 941 878 ctx neighborhood:419 coexpression:799 textmining:535
Rv1038c esxJ ESAT-6 like protein EsxJ 954 865 coexpression:860 textmining:679
Rv2347c esxP ESAT-6 like protein EsxP 920 865 coexpression:860 textmining:438
Rv3620c esxW ESAT-6 like protein EsxW 894 865 coexpression:860
Rv1793 esxN ESAT-6 like protein EsxN 911 860 coexpression:860
Rv2346c esxO ESAT-6 like protein EsxO 911 860 coexpression:860
Rv3619c esxV ESAT-6 like protein EsxV 860 860 coexpression:860
Rv3874 esxB ESAT-6-like protein EsxB 901 803 coexpression:803 textmining:521
Rv1037c esxI ESAT-6 like protein EsxI 804 803 coexpression:803
Rv3648c cspA cold shock protein A 802 803 coexpression:800
Rv3875 esxA ESAT-6 protein EsxA 927 799 coexpression:799 textmining:652
Rv0287 esxG ESAT-6 like protein EsxG 545 427
Rv3020c esxS ESAT-6 like protein EsxS 546 394
Rv3894c eccC2 ESX-2 type VII secretion system protein EccC 488 353

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6 like protein EsxL
  • MTBC0 PGAP product: type VII secretion system ESX-5 protein EsxL
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=3e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215714.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BPBT
  • Curated reference: UniProt P9WNJ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor esxK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001286|Rv1198|esxL
MTINYQFGDVDDHGAMIRAQAGLLEAEHQAIIRDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA