esxN Resolved · high auto-curated

H37Rv Rv1793 · MTBC0 - · 94 aa · 2030694–2030978 (+) · RefSeq YP_177838.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxN
MTBC0 PGAP re-annotation
Revised (this work)ESAT-6 like protein EsxN. Pfam: WXG100 (PF06013.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WNJ3 SwissProt · reviewed · Evidence at protein level
UniProt nameESAT-6-like protein EsxN

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameesxN
eggNOG descriptionBelongs to the WXG100 family
Orthologous group2BPBT
Gene Ontology (7) GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.035 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 5.4e-163–87 Proteins of 100 residues with WXG

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1197 esxK ESAT-6 like protein EsxK 940 865 coexpression:860 textmining:578
Rv2347c esxP ESAT-6 like protein EsxP 935 865 coexpression:860 textmining:542
Rv1038c esxJ ESAT-6 like protein EsxJ 935 865 coexpression:860 textmining:542
Rv3620c esxW ESAT-6 like protein EsxW 906 865 coexpression:860
Rv2346c esxO ESAT-6 like protein EsxO 912 860 coexpression:860 textmining:400
Rv1198 esxL ESAT-6 like protein EsxL 911 860 coexpression:860
Rv3619c esxV ESAT-6 like protein EsxV 860 860 coexpression:860
Rv1037c esxI ESAT-6 like protein EsxI 806 805 coexpression:805
Rv3648c cspA cold shock protein A 804 804 coexpression:802
Rv3875 esxA ESAT-6 protein EsxA 924 797 coexpression:797 textmining:645
Rv1196 PPE18 PPE family protein PPE18 840 772 coexpression:772
Rv3874 esxB ESAT-6-like protein EsxB 916 761 coexpression:761 textmining:664
Rv1871c hyp hypothetical protein 732 732 coexpression:732
Rv1872c lldD2 L-lactate dehydrogenase 730 730 coexpression:730
Rv0685 tuf elongation factor Tu 703 703 coexpression:703

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): ESAT-6 like protein EsxN
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=5e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177838.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BPBT
  • Curated reference: UniProt P9WNJ3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1793|esxN
MTINYQFGDVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA