PE13 Family assigned · medium auto-curated

H37Rv Rv1195 · MTBC0 - · 99 aa · 1339003–1339302 (+) · RefSeq YP_177794.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE family protein PE13
MTBC0 PGAP re-annotation
Revised (this work)PE family protein PE13. Pfam: PE (PF00934.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FR3 SwissProt · reviewed · Evidence at protein level
UniProt namePE family protein PE13
Curated functionMay play a pivotal role in the interaction between M.tuberculosis and host. Can enhance the survival within macrophages under stress conditions such as H(2)O(2), SDS and low pH. Increases the production of IL-6 and IL-1beta from macrophages, and decreases the secretion of suppressor of cytokine signaling 3 (SOCS-3). These changes probably involve the p38-ERK-NF-kappa-B signaling pathway. Also precipitates the macrophage death.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionPE family
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 4.0e-304–94 PE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE18 (PPE family protein PPE18), medium confidence from genomic context alone (score 647 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1196 PPE18 PPE family protein PPE18 908 647 ctx neighborhood:647 textmining:751
Rv1197 esxK ESAT-6 like protein EsxK 640 405 ctx neighborhood:405 textmining:420
Rv1198 esxL ESAT-6 like protein EsxL 713 349 textmining:578
Rv0754 PE_PGRS11 PE-PGRS family protein PE_PGRS11 539 41 textmining:539
Rv0485 transcriptional regulator 518 41 textmining:518
Rv1387 PPE20 PPE family protein PPE20 408 41 textmining:408
Rv1386 PE15 PE family protein PE15 408 41 textmining:409
Rv0256c PPE2 PPE family protein PPE2 408 41 textmining:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE13
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=4e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177794.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt Q79FR3 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor PPE18
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1195|PE13
MSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAAS