PE13 Family assigned · medium auto-curated
H37Rv Rv1195 · MTBC0 - ·
99 aa · 1339003–1339302 (+) ·
RefSeq YP_177794.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE13 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE13. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FR3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PE family protein PE13 |
| Curated function | May play a pivotal role in the interaction between M.tuberculosis and host. Can enhance the survival within macrophages under stress conditions such as H(2)O(2), SDS and low pH. Increases the production of IL-6 and IL-1beta from macrophages, and decreases the secretion of suppressor of cytokine signaling 3 (SOCS-3). These changes probably involve the p38-ERK-NF-kappa-B signaling pathway. Also precipitates the macrophage death. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | PE family |
| Orthologous group | COG0657 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 4.0e-30 | 4–94 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE18 (PPE family protein PPE18), medium confidence from genomic context alone (score 647 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1196 PPE18 |
PPE family protein PPE18 | 908 | 647 ctx | neighborhood:647 textmining:751 |
Rv1197 esxK |
ESAT-6 like protein EsxK | 640 | 405 ctx | neighborhood:405 textmining:420 |
Rv1198 esxL |
ESAT-6 like protein EsxL | 713 | 349 | textmining:578 |
Rv0754 PE_PGRS11 |
PE-PGRS family protein PE_PGRS11 | 539 | 41 | textmining:539 |
Rv0485 |
transcriptional regulator | 518 | 41 | textmining:518 |
Rv1387 PPE20 |
PPE family protein PPE20 | 408 | 41 | textmining:408 |
Rv1386 PE15 |
PE family protein PE15 | 408 | 41 | textmining:409 |
Rv0256c PPE2 |
PPE family protein PPE2 | 408 | 41 | textmining:408 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE13
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=4e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177794.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt Q79FR3 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
8 functional partner(s); context anchor
PPE18 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1195|PE13 MSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAAS