PPE18 Family assigned · medium auto-curated

H37Rv Rv1196 · MTBC0 - · 391 aa · 1339349–1340524 (+) · RefSeq YP_177795.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PPE family protein PPE18
MTBC0 PGAP re-annotation
Revised (this work)PPE family protein PPE18. Pfam: PPE (PF00823.26), PPE-SVP (PF12484.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N675 SwissProt · reviewed · Evidence at protein level
UniProt namePPE family protein PPE18
Curated functionCould be a crucial virulence factor for intracellular survival of M.tuberculosis. Favors development of Th2-type response, and down-regulates the pro-inflammatory and Th1-type response. Specifically interacts with the human Toll-like receptor 2 (TLR2), leading to an early and sustained activation of p38 MAPK, which induces IL-10 production and activates Th2-type immune response. Also inhibits pro-inflammatory cytokines IL-12p40 and TNF production. Acts by up-regulating the expression as well as tyrosine phosphorylation of suppressor of cytokine signaling 3 (SOCS-3), leading to the inhibition o.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
eggNOG descriptionPPE family
Orthologous groupCOG5651

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.597 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 15 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PPEPF00823.26 9.8e-633–164 PPE family
PPE-SVPPF12484.14 7.7e-19306–386 PPE-SVP subfamily C-terminal region

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxK (ESAT-6 like protein EsxK), high confidence from genomic context alone (score 892 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1197 esxK ESAT-6 like protein EsxK 964 892 ctx neighborhood:488 coexpression:798 textmining:685
Rv1198 esxL ESAT-6 like protein EsxL 941 878 ctx neighborhood:419 coexpression:799 textmining:535
Rv3619c esxV ESAT-6 like protein EsxV 858 803 coexpression:803
Rv3620c esxW ESAT-6 like protein EsxW 882 799 coexpression:799 textmining:438
Rv2347c esxP ESAT-6 like protein EsxP 802 774 coexpression:774
Rv1793 esxN ESAT-6 like protein EsxN 840 772 coexpression:772
Rv1038c esxJ ESAT-6 like protein EsxJ 787 744 coexpression:744
Rv2346c esxO ESAT-6 like protein EsxO 778 733 coexpression:733
Rv1361c PPE19 PPE family protein PPE19 732 731 coexpression:731
Rv1195 PE13 PE family protein PE13 908 647 ctx neighborhood:647 textmining:751
Rv1794 espG5 hyp hypothetical protein 463 309
Rv3881c espB ESX-1 secretion-associated protein EspB 577 154 textmining:521
Rv3477 PE31 PE family protein PE31 827 93 textmining:817
Rv3874 esxB ESAT-6-like protein EsxB 441 90 textmining:411
Rv3875 esxA ESAT-6 protein EsxA 658 86 textmining:642

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE18
  • Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=1e-62), PPE-SVP PF12484.14 (E=8e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177795.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26), PPE-SVP (PF12484.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5651
  • Curated reference: UniProt L7N675 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor esxK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1196|PPE18
MVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAG