PPE18 Family assigned · medium auto-curated
H37Rv Rv1196 · MTBC0 - ·
391 aa ·
1339349–1340524 H37Rv
(+) ·
RefSeq YP_177795.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PPE family protein PPE18 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PPE family protein PPE18. Pfam: PPE (PF00823.26), PPE-SVP (PF12484.14). |
| Functional category (TubercuList) | PE/PPE |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 32 publications
32 TB publications mention this gene. 32 publication(s) discuss this gene (31 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Gene conversion is a key driver of diversity hotspots in M. tuberculosis antigens and virulence-associated loci. doi:10.64898/2026.02.26.708061 | 2026 |
| TZ1391: a computationally designed circular mRNA multi-epitope vaccine candidate against Mycobacterium tuberculosis via TLR3 immunomodulation. doi:10.1186/s12865-025-00795-4 | 2026 |
| PPE18 protein of Mycobacterium tuberculosis functions as a virulence factor and is a potential novel therapeutic target. doi:10.1093/jimmun/vkaf146 | 2026 |
| Protective Efficacy of Subunit Vaccine Expressing Rv0976c Against Tuberculosis. doi:10.3390/vaccines13080872 | 2025 |
| Characterization of PPE19 as a novel mediator of Mycobacterium tuberculosis-macrophage interactions. doi:10.1128/msphere.00036-25 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 62% of residues (metapredict) · mean AlphaFold pLDDT 68.3 |
|---|---|
| Disordered regions | 1 IDR(s), longest 232 aa [159-391] |
carries a substantial disordered region (232/391 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
MprA (mprA).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -0.25 (95% CI -3.22 to 3.95). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1228
· 99.0% identity |
|---|---|
| M. marinum |
MMAR_4240
· 55.1% identity |
| M. orygis |
RJtmp_001262
· 99.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
L7N675
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PPE family protein PPE18 |
| Curated function | Could be a crucial virulence factor for intracellular survival of M.tuberculosis. Favors development of Th2-type response, and down-regulates the pro-inflammatory and Th1-type response. Specifically interacts with the human Toll-like receptor 2 (TLR2), leading to an early and sustained activation of p38 MAPK, which induces IL-10 production and activates Th2-type immune response. Also inhibits pro-inflammatory cytokines IL-12p40 and TNF production. Acts by up-regulating the expression as well as tyrosine phosphorylation of suppressor of cytokine signaling 3 (SOCS-3), leading to the inhibition o. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motility
|
|---|---|
| eggNOG description | PPE family |
| Orthologous group | COG5651 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.597 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 9 synonymous, 15 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.18 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 18/53 (34%) · mean identity 62.1%
· 3/4 closest MTBAP relatives present in a subset of the genus (18/53 NTM; in 3 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 11 growth-advantage. Saturation 1.000, mean read count 179. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +1.70 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.27 | 0.013 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.27 | 0.0042 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.13 | 0.011 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.10 | 0.007 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.03 | 0.018 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 228.0 ppm · rank 780/3519 (77.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 391 aa |
|---|---|
| Molecular weight | 39.2 kDa |
| Theoretical pI | 5.07 |
| GRAVY | 0.24 (hydrophobic) |
| Aliphatic index | 82.9 |
| Aromaticity | 0.051 |
| Instability index | 40.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PPE | PF00823.26 | 9.8e-63 | 3–164 | PPE family |
PPE-SVP | PF12484.14 | 7.7e-19 | 306–386 | PPE-SVP subfamily C-terminal region |
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | PE13 (+ strand, 46 bp gap) |
|---|---|
| Downstream (3' on genome) | esxK (+ strand, 134 bp gap) |
| Predicted operon |
PE13 · PPE18
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: esxK (ESAT-6 like protein EsxK), high confidence from genomic context alone (score 892 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1197 esxK |
ESAT-6 like protein EsxK | 964 | 892 ctx | neighborhood:488 coexpression:798 textmining:685 |
Rv1198 esxL |
ESAT-6 like protein EsxL | 941 | 878 ctx | neighborhood:419 coexpression:799 textmining:535 |
Rv3619c esxV |
ESAT-6 like protein EsxV | 858 | 803 | coexpression:803 |
Rv3620c esxW |
ESAT-6 like protein EsxW | 882 | 799 | coexpression:799 textmining:438 |
Rv2347c esxP |
ESAT-6 like protein EsxP | 802 | 774 | coexpression:774 |
Rv1793 esxN |
ESAT-6 like protein EsxN | 840 | 772 | coexpression:772 |
Rv1038c esxJ |
ESAT-6 like protein EsxJ | 787 | 744 | coexpression:744 |
Rv2346c esxO |
ESAT-6 like protein EsxO | 778 | 733 | coexpression:733 |
Rv1361c PPE19 |
PPE family protein PPE19 | 732 | 731 | coexpression:731 |
Rv1195 PE13 |
PE family protein PE13 | 908 | 647 ctx | neighborhood:647 textmining:751 |
Rv1794 espG5 hyp |
hypothetical protein | 463 | 309 | |
Rv3881c espB |
ESX-1 secretion-associated protein EspB | 577 | 154 | textmining:521 |
Rv3477 PE31 |
PE family protein PE31 | 827 | 93 | textmining:817 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 441 | 90 | textmining:411 |
Rv3875 esxA |
ESAT-6 protein EsxA | 658 | 86 | textmining:642 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE18
- Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=1e-62), PPE-SVP PF12484.14 (E=8e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177795.1)
- Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26), PPE-SVP (PF12484.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5651 - Curated reference: UniProt L7N675 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
esxK - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1196|PPE18 MVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for PPE18? Email the maintainer — the message is pre-filled with this gene's details.