Rv1192 Family assigned · low auto-curated

H37Rv Rv1192 · MTBC0 mtbc0_001280 · 275 aa · 1343369–1344196 (+) · RefSeq NP_215708.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05294 TrEMBL · unreviewed · Evidence at protein level
UniProt nameAlpha/beta hydrolase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionacetyltransferases and hydrolases with the alpha beta hydrolase fold
Orthologous groupCOG1075

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.248 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 5 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 2.50% of strains (3632) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD36 (fatty-acid--CoA ligase FadD36), high confidence from genomic context alone (score 847 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1193 fadD36 fatty-acid--CoA ligase FadD36 847 847 ctx neighborhood:823
Rv1191 hyp hypothetical protein 784 784 ctx neighborhood:783
Rv3371 diacyglycerol O-acyltransferase 654 654 ctx cooccurence:652
Rv3130c tgs1 diacyglycerol O-acyltransferase 627 628 ctx cooccurence:624
Rv3480c diacyglycerol O-acyltransferase 605 605 ctx cooccurence:603
Rv2627c hyp hypothetical protein 614 600 ctx cooccurence:408
Rv3088 tgs4 diacyglycerol O-acyltransferase 572 573 ctx cooccurence:570
Rv3087 diacyglycerol O-acyltransferase 570 570 ctx cooccurence:568
Rv2285 diacylglycerol acyltransferase 564 564 ctx cooccurence:563
Rv2940c mas multifunctional mycocerosic acid synthase 530 503 experimental:441
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 529 501 experimental:441
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 529 501 experimental:441
Rv2048c pks12 polyketide synthase 527 500 experimental:441
Rv1527c pks5 polyketide synthase 526 498 experimental:441
Rv1425 diacyglycerol O-acyltransferase 468 469 ctx cooccurence:467

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: alpha/beta hydrolase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215708.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1075
  • Curated reference: UniProt O05294 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor fadD36
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001280|Rv1192|
MLLPVLEPADRPCDAPGWFLYLTDIPRAGVEYGQLLAVLPLQRMLPAGDGHPVLVLPGLLAGDGSTWILRRILRRLGYAAYGWGLGRNIGPTAKAVSGMRDLLDKLHSRYHTPVSLIGWSLGGIFARGLARDHPSAVRQVITLGSPFGMRDTCETRSAWSFNRYAHLHTERHELPLEMESEPLPVPTTAIYSRCDGMVAWQTCMNSPSERAENIAVRSSHIGYGHNPPVVWAIADRLAQPQGAWAPFRPPKVLSPLFPRPDTPAEAVSTPQTRPA