Rv1192 Family assigned · low auto-curated
H37Rv Rv1192 · MTBC0 mtbc0_001280 ·
275 aa · 1343369–1344196 (+) ·
RefSeq NP_215708.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta hydrolase |
| Revised (this work) | Alpha/beta hydrolase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05294
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Alpha/beta hydrolase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | acetyltransferases and hydrolases with the alpha beta hydrolase fold |
| Orthologous group | COG1075 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.248 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 5 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 2.50% of strains (3632) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadD36 (fatty-acid--CoA ligase FadD36), high confidence from genomic context alone (score 847 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1193 fadD36 |
fatty-acid--CoA ligase FadD36 | 847 | 847 ctx | neighborhood:823 |
Rv1191 hyp |
hypothetical protein | 784 | 784 ctx | neighborhood:783 |
Rv3371 |
diacyglycerol O-acyltransferase | 654 | 654 ctx | cooccurence:652 |
Rv3130c tgs1 |
diacyglycerol O-acyltransferase | 627 | 628 ctx | cooccurence:624 |
Rv3480c |
diacyglycerol O-acyltransferase | 605 | 605 ctx | cooccurence:603 |
Rv2627c hyp |
hypothetical protein | 614 | 600 ctx | cooccurence:408 |
Rv3088 tgs4 |
diacyglycerol O-acyltransferase | 572 | 573 ctx | cooccurence:570 |
Rv3087 |
diacyglycerol O-acyltransferase | 570 | 570 ctx | cooccurence:568 |
Rv2285 |
diacylglycerol acyltransferase | 564 | 564 ctx | cooccurence:563 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 530 | 503 | experimental:441 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 529 | 501 | experimental:441 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 529 | 501 | experimental:441 |
Rv2048c pks12 |
polyketide synthase | 527 | 500 | experimental:441 |
Rv1527c pks5 |
polyketide synthase | 526 | 498 | experimental:441 |
Rv1425 |
diacyglycerol O-acyltransferase | 468 | 469 ctx | cooccurence:467 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: alpha/beta hydrolase
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215708.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1075 - Curated reference: UniProt O05294 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
36 functional partner(s); context anchor
fadD36 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001280|Rv1192| MLLPVLEPADRPCDAPGWFLYLTDIPRAGVEYGQLLAVLPLQRMLPAGDGHPVLVLPGLLAGDGSTWILRRILRRLGYAAYGWGLGRNIGPTAKAVSGMRDLLDKLHSRYHTPVSLIGWSLGGIFARGLARDHPSAVRQVITLGSPFGMRDTCETRSAWSFNRYAHLHTERHELPLEMESEPLPVPTTAIYSRCDGMVAWQTCMNSPSERAENIAVRSSHIGYGHNPPVVWAIADRLAQPQGAWAPFRPPKVLSPLFPRPDTPAEAVSTPQTRPA