dapD Resolved · high auto-curated

H37Rv Rv1201c · MTBC0 mtbc0_001289 · 317 aa · 1352658–1353611 (-) · RefSeq NP_215717.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
MTBC0 PGAP re-annotation2%2C3%2C4%2C5-tetrahydropyridine-2%2C6-dicarboxylate N-succinyltransferase
Revised (this work)2%2C3%2C4%2C5-tetrahydropyridine-2%2C6-dicarboxylate N-succinyltransferase. Pfam: THDPS_M (PF14789.12), Hexapep_2 (PF14602.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP21 SwissProt · reviewed · Evidence at protein level
UniProt name2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
EC (curated) EC 2.3.1.117
Curated functionCatalyzes the conversion of the cyclic tetrahydrodipicolinate (THDP) into the acyclic N-succinyl-L-2-amino-6-oxopimelate using succinyl-CoA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namedapD
eggNOG descriptionCatalyzes the conversion of the cyclic tetrahydrodipicolinate (THDP) into the acyclic N-succinyl-L-2- amino-6-oxopimelate using succinyl-CoA
Orthologous groupCOG2171
EC number EC 2.3.1.117
KEGG orthology K00674
KEGG pathways map00300, map01100, map01120, map01230
KEGG modules M00016
Gene Ontology (28) GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0008666, GO:0016020, GO:0016410 +16 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.304 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
THDPS_MPF14789.12 7.1e-21111–150 Tetrahydrodipicolinate N-succinyltransferase middle
Hexapep_2PF14602.13 2.6e-16232–264 Hexapeptide repeat of succinyl-transferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dapE (succinyl-diaminopimelate desuccinylase DapE), high confidence from genomic context alone (score 890 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2773c dapB 4-hydroxy-tetrahydrodipicolinate reductase 987 951 coexpression:416 database:900 textmining:767
Rv0858c dapC N-succinyldiaminopimelate aminotransferase DapC 988 905 database:900 textmining:880
Rv1655 argD acetylornithine aminotransferase 911 904 database:900
Rv1202 dapE succinyl-diaminopimelate desuccinylase DapE 996 890 ctx neighborhood:782 cooccurence:509 textmining:965
Rv3396c guaA GMP synthase 812 709 coexpression:704
Rv3305c amiA1 N-acyl-L-amino acid amidohydrolase AmiA 492 457 coexpression:426
Rv1240 mdh malate dehydrogenase 489 457 coexpression:440
Rv3306c amiB1 amidase AmiB 492 456 coexpression:425
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 612 454 coexpression:452
Rv3834c serS serine--tRNA ligase 510 443 coexpression:424
Rv3661 hyp hypothetical protein 435 436 ctx cooccurence:407
Rv2524c fas fatty acid synthase 581 434 coexpression:418
Rv1093 glyA1 serine hydroxymethyltransferase 466 434 coexpression:419
Rv0070c glyA2 serine hydroxymethyltransferase 463 430 coexpression:415
Rv2448c valS valine--tRNA ligase 472 421 coexpression:421

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  • MTBC0 PGAP product: 2%2C3%2C4%2C5-tetrahydropyridine-2%2C6-dicarboxylate N-succinyltransferase
  • Pfam (hmmscan --cut_ga): THDPS_M PF14789.12 (E=7e-21), Hexapep_2 PF14602.13 (E=3e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215717.1)
  • Domains: Pfam-A via hmmscan --cut_ga — THDPS_M (PF14789.12), Hexapep_2 (PF14602.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2171
  • Curated reference: UniProt P9WP21 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor dapE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001289|Rv1201c|dapD
MSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHAN